(data stored in ACNUC7421 zone)

EMBL: CP002343.PE305

CP002343.PE305       Location/Qualifiers
FT   CDS             338195..339394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0312"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR002104; KEGG: nml:Namu_0644 integrase family
FT                   protein; PFAM: integrase family protein; SPTR: Integrase;
FT                   PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46867"
FT                   /db_xref="GOA:E6S7H2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H2"
FT                   /protein_id="ADU46867.1"
FT                   /translation="MAGRRQKDSETHTTKYRGKDGRWHARVTVGRRIDGQLDRRHLQRK
FT                   TKRELDEAVRALERDRDAGKRTWLQGEQTLGGWLEHWITAILPLSVRWKTLSTYQSLMK
FT                   VHVIPKMGAARLADVRPEALELLYGQLLNEGRSAHVVHAVHRVLRSALGEAVRRHHLSQ
FT                   NPATVARPPRVATVEIDPLTSDECRSLLEAARGTPNAARWSVALALGLRQGEALGLSWD
FT                   DVDLDAGVIHVRRAVQRRTWQHGCGSKPGGQPACGHGRGGYCPQRRAGGLMLVELKTRA
FT                   SRRLIVLPGPLLSELQAHRSDQLRRQEERRGLWDGTHNLVFATDVGGLIDPARDFKDWK
FT                   NLLKAGGVRTVRLHDARHTAATLLLVQGVDLRTVMSIMGWTEMATAQRYVHAVSCLLCT
FT                   "
     MAGRRQKDSE THTTKYRGKD GRWHARVTVG RRIDGQLDRR HLQRKTKREL DEAVRALERD        60
     RDAGKRTWLQ GEQTLGGWLE HWITAILPLS VRWKTLSTYQ SLMKVHVIPK MGAARLADVR       120
     PEALELLYGQ LLNEGRSAHV VHAVHRVLRS ALGEAVRRHH LSQNPATVAR PPRVATVEID       180
     PLTSDECRSL LEAARGTPNA ARWSVALALG LRQGEALGLS WDDVDLDAGV IHVRRAVQRR       240
     TWQHGCGSKP GGQPACGHGR GGYCPQRRAG GLMLVELKTR ASRRLIVLPG PLLSELQAHR       300
     SDQLRRQEER RGLWDGTHNL VFATDVGGLI DPARDFKDWK NLLKAGGVRT VRLHDARHTA       360
     ATLLLVQGVD LRTVMSIMGW TEMATAQRYV HAVSCLLCT                              399
//

If you have problems or comments...

PBIL Back to PBIL home page