(data stored in ACNUC7421 zone)

EMBL: CP002343.PE31

CP002343.PE31        Location/Qualifiers
FT   CDS             complement(33527..33979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_0885 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46593"
FT                   /db_xref="GOA:E6SEJ2"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ2"
FT                   /protein_id="ADU46593.1"
FT                   /translation="MRLPVDDEIYNVNAVWLGPPNRTLPFRARYVAYAVGAVVFLLLQV
FT                   IERRLGIDLGFFSLAYSLLATVALTRLILSVVNPDRPLASVLGAFVHEVSAPRQESRVA
FT                   THTIRPARVRAVPARLSRAQRRLAKKSPAIAGVTATDLGDYQEVAT"
     MRLPVDDEIY NVNAVWLGPP NRTLPFRARY VAYAVGAVVF LLLQVIERRL GIDLGFFSLA        60
     YSLLATVALT RLILSVVNPD RPLASVLGAF VHEVSAPRQE SRVATHTIRP ARVRAVPARL       120
     SRAQRRLAKK SPAIAGVTAT DLGDYQEVAT                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page