(data stored in SCRATCH zone)

EMBL: CP002343.PE311

CP002343.PE311       Location/Qualifiers
FT   CDS             complement(346693..346878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0320"
FT                   /product="protein of unknown function DUF1508"
FT                   /note="COGs: COG3422 conserved hypothetical protein;
FT                   InterPro IPR010879; KEGG: kfl:Kfla_0634 protein of unknown
FT                   function DUF1508; PFAM: protein of unknown function
FT                   DUF1508; SPTR: Putative uncharacterized protein; PFAM:
FT                   Domain of unknown function (DUF1508)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46873"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H8"
FT                   /protein_id="ADU46873.1"
FT                   /translation="MAGKFELYKSASGEYRFRLKATNGQIIATGEGYKTKASALNGIES
FT                   VRKNAQTAQVDDQTAS"
     MAGKFELYKS ASGEYRFRLK ATNGQIIATG EGYKTKASAL NGIESVRKNA QTAQVDDQTA        60
     S                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page