(data stored in ACNUC7421 zone)

EMBL: CP002343.PE313

CP002343.PE313       Location/Qualifiers
FT   CDS             348317..348871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_3427 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46875"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I0"
FT                   /protein_id="ADU46875.1"
FT                   /translation="MTSNARTGVIGLAIVAVLATGGCTDQGLPPATTSSPSATGTTPIT
FT                   TSTTMTAQDPELAAAEATVEKLWKLVDALGADKQRSLDELNTVARDQTLEIWRELLTKR
FT                   RREAIRQTGSTSIVSTEASSARGKLTVDTCFDVSKTNLLDTDGKSVVSENRASRVRYTS
FT                   VVERGSNGNYYVVQDKAVETC"
     MTSNARTGVI GLAIVAVLAT GGCTDQGLPP ATTSSPSATG TTPITTSTTM TAQDPELAAA        60
     EATVEKLWKL VDALGADKQR SLDELNTVAR DQTLEIWREL LTKRRREAIR QTGSTSIVST       120
     EASSARGKLT VDTCFDVSKT NLLDTDGKSV VSENRASRVR YTSVVERGSN GNYYVVQDKA       180
     VETC                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page