(data stored in ACNUC7421 zone)

EMBL: CP002343.PE315

CP002343.PE315       Location/Qualifiers
FT   CDS             complement(351236..351670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0324"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="KEGG: mgi:Mflv_0689 transposase IS116/IS110/IS902
FT                   family protein; SPTR: Putative IS110 family transposase;
FT                   PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46877"
FT                   /db_xref="GOA:E6S7I2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I2"
FT                   /protein_id="ADU46877.1"
FT                   /translation="MEAYDGERVLEMVFIGVDPHKLSATIEVVDDRVLATGRFGTDRAG
FT                   YAAMRRHVAAYRERVWAVEGSNGAGRPLAQRLLADGEHVVDVRASLSRRARALDTGHNR
FT                   KTDAHDAHAVAVVAVRTTGLRVLAYDVELEALRMLVARSE"
     MEAYDGERVL EMVFIGVDPH KLSATIEVVD DRVLATGRFG TDRAGYAAMR RHVAAYRERV        60
     WAVEGSNGAG RPLAQRLLAD GEHVVDVRAS LSRRARALDT GHNRKTDAHD AHAVAVVAVR       120
     TTGLRVLAYD VELEALRMLV ARSE                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page