(data stored in ACNUC7421 zone)

EMBL: CP002343.PE316

CP002343.PE316       Location/Qualifiers
FT   CDS             352205..353956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0325"
FT                   /product="Domain of unknown function DUF1994"
FT                   /note="COGs: COG2247 Putative cell wall-binding domain;
FT                   InterPro IPR018532: IPR007253; KEGG: sna:Snas_5967
FT                   hypothetical protein; PFAM: Domain of unknown function
FT                   DUF1994; cell wall binding repeat 2-containing protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: Putative cell
FT                   wall binding repeat 2; Domain of unknown function
FT                   (DUF1994)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46878"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I3"
FT                   /protein_id="ADU46878.1"
FT                   /translation="MHPWSRLTSFLAAGVVSFAAAVAAAPPVQAAPVTAASLPAMLSVQ
FT                   AEDGAHDYSRDYFPLWIDADRDGCNTRYEVLIAESTTQVTVGAGCSLSGGAWLSPYDAA
FT                   TWTDPADVDIDHMVALAEAWRSGAWAWTTDQRTQYANDLDVDYALVAVTDNVNQAKGDQ
FT                   DPAEWLPPYIPFQCQYVIDWALVKYRWSLSIDPAEEAAVVAMLSGACGDTIVTLPTQQV
FT                   STTTPAGGAVTGFPDGITRLAGATRYETAIQVSQRYAPGVPAVYVATGTNFPDALSAAA
FT                   AAAQVGGPLLLTSPTALPSAVKTEITRLNPARIYLLGGTAAVSSAVATTLATIAPVTRY
FT                   DGADRYATGLNIVNSTFASAATAMIATGRSFPDALAATGAAGKVDAPVILVDGTRSTVT
FT                   SDTLSALTRLGVRHVTVAGGTAVVSTGIVTQLQSLGLTVTRYGGSDRYATAALINNAYF
FT                   PTGSTDTMFLATGTNFPDALAGAALAGRLGAPQYVTAAACAPAPIHDSVAALAPGKTAV
FT                   LGGTAVVSDIAAMNWECPPGKLFPDPVTPGAFCASTYSGWYGYTTTGTLMRCTTTATDS
FT                   RLRWRAA"
     MHPWSRLTSF LAAGVVSFAA AVAAAPPVQA APVTAASLPA MLSVQAEDGA HDYSRDYFPL        60
     WIDADRDGCN TRYEVLIAES TTQVTVGAGC SLSGGAWLSP YDAATWTDPA DVDIDHMVAL       120
     AEAWRSGAWA WTTDQRTQYA NDLDVDYALV AVTDNVNQAK GDQDPAEWLP PYIPFQCQYV       180
     IDWALVKYRW SLSIDPAEEA AVVAMLSGAC GDTIVTLPTQ QVSTTTPAGG AVTGFPDGIT       240
     RLAGATRYET AIQVSQRYAP GVPAVYVATG TNFPDALSAA AAAAQVGGPL LLTSPTALPS       300
     AVKTEITRLN PARIYLLGGT AAVSSAVATT LATIAPVTRY DGADRYATGL NIVNSTFASA       360
     ATAMIATGRS FPDALAATGA AGKVDAPVIL VDGTRSTVTS DTLSALTRLG VRHVTVAGGT       420
     AVVSTGIVTQ LQSLGLTVTR YGGSDRYATA ALINNAYFPT GSTDTMFLAT GTNFPDALAG       480
     AALAGRLGAP QYVTAAACAP APIHDSVAAL APGKTAVLGG TAVVSDIAAM NWECPPGKLF       540
     PDPVTPGAFC ASTYSGWYGY TTTGTLMRCT TTATDSRLRW RAA                         583
//

If you have problems or comments...

PBIL Back to PBIL home page