(data stored in ACNUC7421 zone)

EMBL: CP002343.PE319

CP002343.PE319       Location/Qualifiers
FT   CDS             complement(356358..356603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0329"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dol:Dole_1753 FG-GAP repeat-containing
FT                   protein; SPTR: Amyloid protein a variant 2"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46881"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I6"
FT                   /protein_id="ADU46881.1"
FT                   /translation="MKGKSGQAGSLQDVDGDGDLDLVVQIEDTDGTYSLGDATAYLTAK
FT                   TYSGENVKVPTRSESSPPPAEDTHVGARASRHTAGT"
     MKGKSGQAGS LQDVDGDGDL DLVVQIEDTD GTYSLGDATA YLTAKTYSGE NVKVPTRSES        60
     SPPPAEDTHV GARASRHTAG T                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page