(data stored in ACNUC7421 zone)

EMBL: CP002343.PE32

CP002343.PE32        Location/Qualifiers
FT   CDS             complement(33984..34235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_0884 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46594"
FT                   /db_xref="GOA:E6SEJ3"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ3"
FT                   /protein_id="ADU46594.1"
FT                   /translation="MHTLETLATAAGTTGLQGWIKANIIPLLLLLIATMLFVLAQRGDN
FT                   AKAMRVVSGVIIALAVLGLATSGKADSLGSWMASLITG"
     MHTLETLATA AGTTGLQGWI KANIIPLLLL LIATMLFVLA QRGDNAKAMR VVSGVIIALA        60
     VLGLATSGKA DSLGSWMASL ITG                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page