(data stored in SCRATCH zone)

EMBL: CP002343.PE320

CP002343.PE320       Location/Qualifiers
FT   CDS             complement(356600..357121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0330"
FT                   /product="C-type lectin domain protein"
FT                   /note="InterPro IPR001304; KEGG: plt:Plut_0367 VCBS; PFAM:
FT                   C-type lectin domain protein; SMART: C-type lectin domain
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Lectin C-type domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46882"
FT                   /db_xref="GOA:E6S7I7"
FT                   /db_xref="InterPro:IPR001304"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I7"
FT                   /protein_id="ADU46882.1"
FT                   /translation="MTWHQARSAAAERTQGGPLCAGHLATITTADEQAFLFSTFGEGLH
FT                   TTWLGGYQTDGATEPAGGWTWITGETWGYTNWLLGEPNNSGGEDALAFLGTNGKWNDAP
FT                   ELYNYGASGGYVVEYEGRQVAMTSSPEATTTASTTTATVSSRWPSSPRPRSTRPRSTPP
FT                   RSLSMAPASK"
     MTWHQARSAA AERTQGGPLC AGHLATITTA DEQAFLFSTF GEGLHTTWLG GYQTDGATEP        60
     AGGWTWITGE TWGYTNWLLG EPNNSGGEDA LAFLGTNGKW NDAPELYNYG ASGGYVVEYE       120
     GRQVAMTSSP EATTTASTTT ATVSSRWPSS PRPRSTRPRS TPPRSLSMAP ASK              173
//

If you have problems or comments...

PBIL Back to PBIL home page