(data stored in ACNUC7421 zone)

EMBL: CP002343.PE323

CP002343.PE323       Location/Qualifiers
FT   CDS             359551..359928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0334"
FT                   /product="HEPN domain protein"
FT                   /note="InterPro IPR007842; KEGG: nca:Noca_3210 hypothetical
FT                   protein; PFAM: HEPN domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: HEPN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46885"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J0"
FT                   /protein_id="ADU46885.1"
FT                   /translation="MSALTQARDHLNKAREFLEAAEIDLDLEFFSAATSHAVIAGINSK
FT                   DAICLKLTGRTTKGDKHHEAVAELKPAGPEGADVAATMSRLLKLKTKAQYLAPAIGRKD
FT                   ASKAVEWATRMVEQAIAEVSR"
     MSALTQARDH LNKAREFLEA AEIDLDLEFF SAATSHAVIA GINSKDAICL KLTGRTTKGD        60
     KHHEAVAELK PAGPEGADVA ATMSRLLKLK TKAQYLAPAI GRKDASKAVE WATRMVEQAI       120
     AEVSR                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page