(data stored in ACNUC7421 zone)

EMBL: CP002343.PE324

CP002343.PE324       Location/Qualifiers
FT   CDS             complement(360850..361059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0335"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /note="KEGG: kfl:Kfla_4023 putative RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily; SPTR: Putative RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46886"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J1"
FT                   /protein_id="ADU46886.1"
FT                   /translation="MRKRPGARLSHLATSSTEDFLVADQDYAVLAVLGDAVDTAARRWP
FT                   AASTPDNPSAGLLTTSRRRSLRLG"
     MRKRPGARLS HLATSSTEDF LVADQDYAVL AVLGDAVDTA ARRWPAASTP DNPSAGLLTT        60
     SRRRSLRLG                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page