(data stored in ACNUC7421 zone)

EMBL: CP002343.PE326

CP002343.PE326       Location/Qualifiers
FT   CDS             363033..364058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0337"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1064 Zn-dependent alcohol dehydrogenase;
FT                   InterPro IPR013154: IPR013149: IPR002328; KEGG:
FT                   sma:SAV_1393 alcohol dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase GroES domain protein; Alcohol dehydrogenase
FT                   zinc-binding domain protein; SPTR: Putative alcohol
FT                   dehydrogenase; PFAM: Alcohol dehydrogenase GroES-like
FT                   domain; Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46888"
FT                   /db_xref="GOA:E6S7J3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J3"
FT                   /protein_id="ADU46888.1"
FT                   /translation="MKAVRLVGYEQQPQLMDVPDPTPSSPLDVVIRIGGAGVCRTDLHI
FT                   IEGQWEEKSGVALPYTIGHENAGWVEAVGSAVTNVKPGDPVILHPLATCGLCRACRAGD
FT                   DVHCVNSSFPGIDSDGGYAEYLRTTARSVVRLDDSLEPADVAALADAGLTAYHAVAKAA
FT                   RVLRPGDTAVAIGAGGLGHIGIQVFKALSPARLVVVDRSPEALELASELGADVTLRADG
FT                   TQVEAIQELTQGNGAEAILDFVGEGGAVEDGVQMLRRAGNYYVIGYGGEIRVPTIDVIS
FT                   TEINFIGNLVGSYNDLVELMVLAAEDRVRLHTQRYALSDFQKALDDLDAGLVRGRAILV
FT                   P"
     MKAVRLVGYE QQPQLMDVPD PTPSSPLDVV IRIGGAGVCR TDLHIIEGQW EEKSGVALPY        60
     TIGHENAGWV EAVGSAVTNV KPGDPVILHP LATCGLCRAC RAGDDVHCVN SSFPGIDSDG       120
     GYAEYLRTTA RSVVRLDDSL EPADVAALAD AGLTAYHAVA KAARVLRPGD TAVAIGAGGL       180
     GHIGIQVFKA LSPARLVVVD RSPEALELAS ELGADVTLRA DGTQVEAIQE LTQGNGAEAI       240
     LDFVGEGGAV EDGVQMLRRA GNYYVIGYGG EIRVPTIDVI STEINFIGNL VGSYNDLVEL       300
     MVLAAEDRVR LHTQRYALSD FQKALDDLDA GLVRGRAILV P                           341
//

If you have problems or comments...

PBIL Back to PBIL home page