(data stored in SCRATCH zone)

EMBL: CP002343.PE329

CP002343.PE329       Location/Qualifiers
FT   CDS             366658..367500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0340"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: sma:SAV_1396
FT                   ABC transporter permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Putative multiple sugar ABC transporter
FT                   permease protein; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46891"
FT                   /db_xref="GOA:E6S7J6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J6"
FT                   /protein_id="ADU46891.1"
FT                   /translation="MPRLYPIFKYAFITVWACFVAGPFLWALTTSFKDDNGVQHGATYL
FT                   PWVQYRPTTLAWRNIFGGAGGVDVIKPFLNSLIVTVSASVVALILGSLAAYGLSRYTYR
FT                   FGPMKNPDIVFFFVSQRIMPPIVLVIPFFFLLQFGGLLDSIPGLVIVTVSLLLPISVWV
FT                   MVDFFDNIPKEIDEMAMLEGCTPLGAFTRAILPNSLPGLTVAAMFCAVFGWNDFFFAFR
FT                   LTFTEVQTLPQAVVALNSSIPPWWTLSAASLFGVAPLVLLAIMVERYLSKGNLSGAVR"
     MPRLYPIFKY AFITVWACFV AGPFLWALTT SFKDDNGVQH GATYLPWVQY RPTTLAWRNI        60
     FGGAGGVDVI KPFLNSLIVT VSASVVALIL GSLAAYGLSR YTYRFGPMKN PDIVFFFVSQ       120
     RIMPPIVLVI PFFFLLQFGG LLDSIPGLVI VTVSLLLPIS VWVMVDFFDN IPKEIDEMAM       180
     LEGCTPLGAF TRAILPNSLP GLTVAAMFCA VFGWNDFFFA FRLTFTEVQT LPQAVVALNS       240
     SIPPWWTLSA ASLFGVAPLV LLAIMVERYL SKGNLSGAVR                             280
//

If you have problems or comments...

PBIL Back to PBIL home page