(data stored in ACNUC7421 zone)

EMBL: CP002343.PE330

CP002343.PE330       Location/Qualifiers
FT   CDS             367497..368576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0341"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="COGs: COG3839 ABC-type sugar transport systems
FT                   ATPase components; InterPro IPR003439: IPR013611:
FT                   IPR003593: IPR017871; KEGG: sma:SAV_1397 sugar ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; Transport-associated OB domain-containing protein;
FT                   SMART: AAA ATPase; SPTR: Putative multiple sugar ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46892"
FT                   /db_xref="GOA:E6S7J7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J7"
FT                   /protein_id="ADU46892.1"
FT                   /translation="MSLTLTGVSLAVDGAAHLDSIDLDFQAGRIYTIIGRTLAGKTTLL
FT                   RALAGLSPVDTGRIELDGADMQDVPPWKRDTAMVYQQFINYPHLSVMDNVCFPLKRAGL
FT                   DAAEVRQRAEENLEKVGLTPFAHRRPRQLSGGQQQRVALARALARRSRILLLDEPLVNL
FT                   DYKLREQLREDLRGLFSGVGDAIVVYTTTEPTEALMLGDEVVVMHEGRVLQVAAPAEVF
FT                   ERPLNTDVARIINDPPMNLFDGVVAGDWISFGGLAEIHCPAHLAGLPDGPYRFGLRATD
FT                   IRPSSRSPVSGEVTFVEISGSETFVHLSVGDAALVMRAEGIHDLAIGDPERVELRAERL
FT                   FVFGPDGRLRVAPETNERF"
     MSLTLTGVSL AVDGAAHLDS IDLDFQAGRI YTIIGRTLAG KTTLLRALAG LSPVDTGRIE        60
     LDGADMQDVP PWKRDTAMVY QQFINYPHLS VMDNVCFPLK RAGLDAAEVR QRAEENLEKV       120
     GLTPFAHRRP RQLSGGQQQR VALARALARR SRILLLDEPL VNLDYKLREQ LREDLRGLFS       180
     GVGDAIVVYT TTEPTEALML GDEVVVMHEG RVLQVAAPAE VFERPLNTDV ARIINDPPMN       240
     LFDGVVAGDW ISFGGLAEIH CPAHLAGLPD GPYRFGLRAT DIRPSSRSPV SGEVTFVEIS       300
     GSETFVHLSV GDAALVMRAE GIHDLAIGDP ERVELRAERL FVFGPDGRLR VAPETNERF        359
//

If you have problems or comments...

PBIL Back to PBIL home page