(data stored in ACNUC7421 zone)

EMBL: CP002343.PE331

CP002343.PE331       Location/Qualifiers
FT   CDS             368581..369663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0342"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="COGs: COG3839 ABC-type sugar transport systems
FT                   ATPase components; InterPro IPR003439: IPR013611:
FT                   IPR003593; KEGG: sma:SAV_1398 sugar ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; SMART:
FT                   AAA ATPase; SPTR: Putative multiple sugar ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter; TOBE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46893"
FT                   /db_xref="GOA:E6S7J8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J8"
FT                   /protein_id="ADU46893.1"
FT                   /translation="MARIDLTDVGHAYSRGDGSEDWALKPLSLSFDSGKTYALVGPSGC
FT                   GKTTMLNIISGLIRPSQGRVSFDGVDVTARPTRHRNIAQVFQFPVIYRSMSVRDNLAFP
FT                   LECRGWEQPRIDTRVGSVAEALGLSHRLDRAARHLSADEKQLISLGRGLVRDDVAAVLM
FT                   DEPLTVIDPQLKFSLRRKIRELSEQFQPTVIYVTHDQYEAMSFAQEVLVMRHGRIMQQG
FT                   TPEQLFESPRSTYVGYFVGSPAMNYLDAAWDGSAATVAGVPVTPAWAPPVRAGARFQLG
FT                   IRPEYVRLVQRSGPNTLPATLHSVRDHGPTRVCHVDIGGQSATVKVPREHPIPSEPLLY
FT                   LEMPRAKVLPYVEGELAVVD"
     MARIDLTDVG HAYSRGDGSE DWALKPLSLS FDSGKTYALV GPSGCGKTTM LNIISGLIRP        60
     SQGRVSFDGV DVTARPTRHR NIAQVFQFPV IYRSMSVRDN LAFPLECRGW EQPRIDTRVG       120
     SVAEALGLSH RLDRAARHLS ADEKQLISLG RGLVRDDVAA VLMDEPLTVI DPQLKFSLRR       180
     KIRELSEQFQ PTVIYVTHDQ YEAMSFAQEV LVMRHGRIMQ QGTPEQLFES PRSTYVGYFV       240
     GSPAMNYLDA AWDGSAATVA GVPVTPAWAP PVRAGARFQL GIRPEYVRLV QRSGPNTLPA       300
     TLHSVRDHGP TRVCHVDIGG QSATVKVPRE HPIPSEPLLY LEMPRAKVLP YVEGELAVVD       360
//

If you have problems or comments...

PBIL Back to PBIL home page