(data stored in SCRATCH zone)

EMBL: CP002343.PE332

CP002343.PE332       Location/Qualifiers
FT   CDS             complement(370918..371550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0345"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: rop:ROP_pROB01-03010 putative methyltransferase;
FT                   PFAM: Methyltransferase type 11; SPTR: Methyltransferase
FT                   type 11; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46894"
FT                   /db_xref="GOA:E6S7J9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J9"
FT                   /protein_id="ADU46894.1"
FT                   /translation="MKKDAYGRLARLQDAALEPLNAPLREIAVRVSGVGGGSRVLDVGC
FT                   GTGTQLERYLAAGCDVSGIDTSPAMLARARERLGSAADLRLADAQRIPFEDAMFDVVTA
FT                   TLVLHELRPLECEAVGKEMARVLTDSGRLVVIDFSPGPLRGLKGWGLRGFSVLAELTAR
FT                   HLQRSRTFLAAGGVPRLAELLGMELQHTKFVGGGNMAVYVLTRRGTG"
     MKKDAYGRLA RLQDAALEPL NAPLREIAVR VSGVGGGSRV LDVGCGTGTQ LERYLAAGCD        60
     VSGIDTSPAM LARARERLGS AADLRLADAQ RIPFEDAMFD VVTATLVLHE LRPLECEAVG       120
     KEMARVLTDS GRLVVIDFSP GPLRGLKGWG LRGFSVLAEL TARHLQRSRT FLAAGGVPRL       180
     AELLGMELQH TKFVGGGNMA VYVLTRRGTG                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page