(data stored in ACNUC7421 zone)

EMBL: CP002343.PE334

CP002343.PE334       Location/Qualifiers
FT   CDS             complement(373232..373393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lbz:LbrM25_V2.0520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46896"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K1"
FT                   /protein_id="ADU46896.1"
FT                   /translation="MNLHSTTGTEPERLTLPAADPTGVLLTHAPNEASPLTAEVRGWFV
FT                   VSGGITLG"
     MNLHSTTGTE PERLTLPAAD PTGVLLTHAP NEASPLTAEV RGWFVVSGGI TLG               53
//

If you have problems or comments...

PBIL Back to PBIL home page