(data stored in ACNUC7421 zone)

EMBL: CP002343.PE337

CP002343.PE337       Location/Qualifiers
FT   CDS             complement(377062..377325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0350"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="COGs: COG2026 Cytotoxic translational repressor of
FT                   toxin-antitoxin stability system; InterPro IPR007712:
FT                   IPR012753; KEGG: gob:Gobs_3715 addiction module toxin,
FT                   RelE/StbE family; PFAM: plasmid stabilization system; SPTR:
FT                   Addiction module toxin, RelE/StbE family; TIGRFAM:
FT                   addiction module toxin, RelE/StbE family; PFAM: Plasmid
FT                   stabilisation system protein; TIGRFAM: addiction module
FT                   toxin, RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46899"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K4"
FT                   /protein_id="ADU46899.1"
FT                   /translation="MTYRIDVAPAALRQLRKLDPAARRRVQAAIELLAEQPRPSAAKKL
FT                   TGGEGEWRVRTGDHRIIYEIHDQVLLLFVVAIGHRRDIYSRR"
     MTYRIDVAPA ALRQLRKLDP AARRRVQAAI ELLAEQPRPS AAKKLTGGEG EWRVRTGDHR        60
     IIYEIHDQVL LLFVVAIGHR RDIYSRR                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page