(data stored in ACNUC7421 zone)

EMBL: CP002343.PE338

CP002343.PE338       Location/Qualifiers
FT   CDS             complement(377322..377576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0351"
FT                   /product="prevent-host-death family protein"
FT                   /note="InterPro IPR006442; KEGG: aau:AAur_0708
FT                   prevent-host-death protein; SPTR: Prevent-host-death
FT                   protein; TIGRFAM: prevent-host-death family protein; PFAM:
FT                   Phd_YefM; TIGRFAM: prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46900"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K5"
FT                   /protein_id="ADU46900.1"
FT                   /translation="MTVSDARARLADVVDAARVQHDPVYLTRRGQRVAAVIDADDLDRL
FT                   IAAAEDLADIEAARAARAEIADGEAAIPWEQVKADLGLA"
     MTVSDARARL ADVVDAARVQ HDPVYLTRRG QRVAAVIDAD DLDRLIAAAE DLADIEAARA        60
     ARAEIADGEA AIPWEQVKAD LGLA                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page