(data stored in SCRATCH zone)

EMBL: CP002343.PE339

CP002343.PE339       Location/Qualifiers
FT   CDS             complement(377744..378133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0352"
FT                   /product="death-on-curing family protein"
FT                   /note="COGs: COG3654 Prophage maintenance system killer
FT                   protein; InterPro IPR003812: IPR006440; KEGG: kra:Krad_2677
FT                   death-on-curing family protein; PFAM: filamentation induced
FT                   by cAMP protein Fic; SPTR: Death-on-curing family protein;
FT                   TIGRFAM: death-on-curing family protein; PFAM: Fic/DOC
FT                   family; TIGRFAM: death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46901"
FT                   /db_xref="GOA:E6S7K6"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K6"
FT                   /protein_id="ADU46901.1"
FT                   /translation="MSNEDLDYLSLEDLLEIATGVMDEVVVRDVGLLAAAAARPRVTVF
FT                   GDDAYPTFEDKAAALLHSLVRNHALVDGNKRLAWSATRVFCLLNGRDLTYDVDDAEGLM
FT                   VDAAAGQLDVPQIASWLGAHMEATS"
     MSNEDLDYLS LEDLLEIATG VMDEVVVRDV GLLAAAAARP RVTVFGDDAY PTFEDKAAAL        60
     LHSLVRNHAL VDGNKRLAWS ATRVFCLLNG RDLTYDVDDA EGLMVDAAAG QLDVPQIASW       120
     LGAHMEATS                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page