(data stored in ACNUC7421 zone)

EMBL: CP002343.PE34

CP002343.PE34        Location/Qualifiers
FT   CDS             36223..37614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgo:TGME49_020220 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46596"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ5"
FT                   /protein_id="ADU46596.1"
FT                   /translation="MRHTRVGGLEVIHRLGQLGAALGYEVREEHRVGRSAAVDLSWTAA
FT                   ASNDAPLFVFEVESTPSTGLANNALKVYGSPLEELVKPLFFFHLVLSGGQDNERIRNAQ
FT                   RLFGQHNYRIYRLTDGTPAPDLALDILRQHRRVSRNLDLWSTATALMEPGWGGLATVFA
FT                   VLELAEQLRFESAYLCDYARLSMEDPAYVGLFARRVRTLSERPEANGPEGREASNPRPR
FT                   DGYGGGPGDYISGLLETGIRIYAGDLADEDGPAAFETWMTSCGFGQRMIEPSFGLSRDY
FT                   DGYVIGTAPIHYALTAALLKRHPRSHEWVIRDLANLLEGEFDRGLRPRFRLPAVLWLAH
FT                   ILAASPTEHDVATQRDPTFFDGLYARLGEHVREGGGLPAKLLLDPPRPFNPSEDVPEWI
FT                   DEEEVVSLPSREALRAKGLALRGPTVPSGHPTAIQACLSSLISYEVYADPGAVILPLLY
FT                   AEAAD"
     MRHTRVGGLE VIHRLGQLGA ALGYEVREEH RVGRSAAVDL SWTAAASNDA PLFVFEVEST        60
     PSTGLANNAL KVYGSPLEEL VKPLFFFHLV LSGGQDNERI RNAQRLFGQH NYRIYRLTDG       120
     TPAPDLALDI LRQHRRVSRN LDLWSTATAL MEPGWGGLAT VFAVLELAEQ LRFESAYLCD       180
     YARLSMEDPA YVGLFARRVR TLSERPEANG PEGREASNPR PRDGYGGGPG DYISGLLETG       240
     IRIYAGDLAD EDGPAAFETW MTSCGFGQRM IEPSFGLSRD YDGYVIGTAP IHYALTAALL       300
     KRHPRSHEWV IRDLANLLEG EFDRGLRPRF RLPAVLWLAH ILAASPTEHD VATQRDPTFF       360
     DGLYARLGEH VREGGGLPAK LLLDPPRPFN PSEDVPEWID EEEVVSLPSR EALRAKGLAL       420
     RGPTVPSGHP TAIQACLSSL ISYEVYADPG AVILPLLYAE AAD                         463
//

If you have problems or comments...

PBIL Back to PBIL home page