(data stored in SCRATCH zone)

EMBL: CP002343.PE343

CP002343.PE343       Location/Qualifiers
FT   CDS             381490..382533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_6800 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Predicted membrane
FT                   protein (DUF2157)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46905"
FT                   /db_xref="GOA:E6S7L0"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L0"
FT                   /protein_id="ADU46905.1"
FT                   /translation="MAVGLEIVLTRGVAEGVITGEQAERLRHLGEDGTGPVPGEGAWQS
FT                   PTRRGPSLVTEALGYLGGIILLVGAILIGSQYWPDVDPLVRLGVVVLVAVAFVVAGGLV
FT                   PRGLDAVGTRLRSVLWALSVAAGTGAAAILFYDVVDLDDDHVPVLMFLLATVYALALWT
FT                   WRPTGLQLAVAAAGTAVTAGLLVMLLVESFDAAIAGVLVVGVVWLALGWAAVIRPPRAA
FT                   LVVGAGIVFLGSQMYVVGGSGPIWAVLASAGLVGVALYHRDLIILGIGSLGLLFALPNL
FT                   IYEWFPSVVAAAVSLLVVGGLLVVAALYTARRGRQHPGDGPAKGPANGAAGGPANGPAT
FT                   TPAGQER"
     MAVGLEIVLT RGVAEGVITG EQAERLRHLG EDGTGPVPGE GAWQSPTRRG PSLVTEALGY        60
     LGGIILLVGA ILIGSQYWPD VDPLVRLGVV VLVAVAFVVA GGLVPRGLDA VGTRLRSVLW       120
     ALSVAAGTGA AAILFYDVVD LDDDHVPVLM FLLATVYALA LWTWRPTGLQ LAVAAAGTAV       180
     TAGLLVMLLV ESFDAAIAGV LVVGVVWLAL GWAAVIRPPR AALVVGAGIV FLGSQMYVVG       240
     GSGPIWAVLA SAGLVGVALY HRDLIILGIG SLGLLFALPN LIYEWFPSVV AAAVSLLVVG       300
     GLLVVAALYT ARRGRQHPGD GPAKGPANGA AGGPANGPAT TPAGQER                     347
//

If you have problems or comments...

PBIL Back to PBIL home page