(data stored in SCRATCH zone)

EMBL: CP002343.PE348

CP002343.PE348       Location/Qualifiers
FT   CDS             complement(388233..389291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0361"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="COGs: COG4177 ABC-type branched-chain amino acid
FT                   transport system permease component; InterPro IPR001851;
FT                   KEGG: chl:Chy400_1185 inner-membrane translocator; PFAM:
FT                   inner-membrane translocator; SPTR: Inner-membrane
FT                   translocator; PFAM: Branched-chain amino acid transport
FT                   system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46910"
FT                   /db_xref="GOA:E6S7L5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L5"
FT                   /protein_id="ADU46910.1"
FT                   /translation="MATATGIHHRTYRSELRLRHTKAEYFRLALMLVLLLAAPYVLDKY
FT                   WLGIANVILISVIGAVGLNILVGFTGQISLGQGGFLAVGAFTSVIISDRAGVPVPISIA
FT                   IAVLMTAAVGAFFGLPALRLKGLYLAIATLASQEIIMFVVRRWEWLTEGKGYLEVERLH
FT                   VGGFQVERQMFEVQWYWILLALATLAVVVARNLFRTTLGRSFMAVRDQDIAAEAIGVNI
FT                   TRAKVTAFAVSSGFVGLAGALTAHYTETVTWERFTLDVSVLYLAMIIVGGLGSIAGAVY
FT                   GAIFMGLLPALLTELVDVLGSSLPSLSDQLPALRNAVFGIAIIVFLLVEPRGLDRIWTR
FT                   MKDYVRFWPFRY"
     MATATGIHHR TYRSELRLRH TKAEYFRLAL MLVLLLAAPY VLDKYWLGIA NVILISVIGA        60
     VGLNILVGFT GQISLGQGGF LAVGAFTSVI ISDRAGVPVP ISIAIAVLMT AAVGAFFGLP       120
     ALRLKGLYLA IATLASQEII MFVVRRWEWL TEGKGYLEVE RLHVGGFQVE RQMFEVQWYW       180
     ILLALATLAV VVARNLFRTT LGRSFMAVRD QDIAAEAIGV NITRAKVTAF AVSSGFVGLA       240
     GALTAHYTET VTWERFTLDV SVLYLAMIIV GGLGSIAGAV YGAIFMGLLP ALLTELVDVL       300
     GSSLPSLSDQ LPALRNAVFG IAIIVFLLVE PRGLDRIWTR MKDYVRFWPF RY               352
//

If you have problems or comments...

PBIL Back to PBIL home page