(data stored in ACNUC7421 zone)

EMBL: CP002343.PE350

CP002343.PE350       Location/Qualifiers
FT   CDS             complement(390164..392200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0363"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG1022 Long-chain acyl-CoA synthetase
FT                   (AMP-forming); InterPro IPR000873: IPR020845; KEGG:
FT                   rrs:RoseRS_0623 AMP-dependent synthetase and ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; SPTR: AMP-dependent
FT                   synthetase and ligase; PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46912"
FT                   /db_xref="GOA:E6S7L7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L7"
FT                   /protein_id="ADU46912.1"
FT                   /translation="MSTEKTPYAADLAPSEPSGSRGASPAAYGTASGDTFPRLLAGLAA
FT                   QRPNDTALQEKRYGIWQPLTWAQYNKRVRDFAHGLAALGVERGQIVAVLGDNRPEWLIA
FT                   ELAAQSLGASVVGVYPTSIGEELHHILTHSRARVVIAEDQEQVDKLIRLRSEAADLPME
FT                   TVVYYDPHGLEAYTDEFLTDFTAVEAQGREWGDEHPGWLDEQIASGRPEDVAVICTTSG
FT                   TTSRPKLAELSHANLLAMAEHLTTIDPIGARDRYVSFLPFAWIGEQMLAVACGLSRGLT
FT                   LSFPEDSATQKTDLREIGPNVMFSPPRIWESMLSEVQVRIDEAGWLKRKVFGWGYAIGD
FT                   RVAEQRIHGKAKAIDPLYWLADQVALRPVRDQLGLARIDHAYTGGAPLGPDVFRFFHAI
FT                   GVNLKQIYGQTEICGIAVVHRDDDIAFASVGTPIPGTEIRITDEGEILLRSASVFRGYH
FT                   RNPEATAEAVDADGWLHTGDAGFLDEQGHLVVIDRAKDVLTTSDGTRFSSAFIENKLKF
FT                   SPYVEEAVTFPTDHGMTAMITIDPMTTGSWAEHERLSYTTYTDLAGKQEVRDLIAEEVL
FT                   RANEDLPESIRIKRFVLLHKQFDPDDDEITRTRKVRRNVIAERYADIINGLAGGSDDVT
FT                   IRSLVTYQDGSQVERNLVLKIVDMSTFRAPEGRGRRPVWSGRR"
     MSTEKTPYAA DLAPSEPSGS RGASPAAYGT ASGDTFPRLL AGLAAQRPND TALQEKRYGI        60
     WQPLTWAQYN KRVRDFAHGL AALGVERGQI VAVLGDNRPE WLIAELAAQS LGASVVGVYP       120
     TSIGEELHHI LTHSRARVVI AEDQEQVDKL IRLRSEAADL PMETVVYYDP HGLEAYTDEF       180
     LTDFTAVEAQ GREWGDEHPG WLDEQIASGR PEDVAVICTT SGTTSRPKLA ELSHANLLAM       240
     AEHLTTIDPI GARDRYVSFL PFAWIGEQML AVACGLSRGL TLSFPEDSAT QKTDLREIGP       300
     NVMFSPPRIW ESMLSEVQVR IDEAGWLKRK VFGWGYAIGD RVAEQRIHGK AKAIDPLYWL       360
     ADQVALRPVR DQLGLARIDH AYTGGAPLGP DVFRFFHAIG VNLKQIYGQT EICGIAVVHR       420
     DDDIAFASVG TPIPGTEIRI TDEGEILLRS ASVFRGYHRN PEATAEAVDA DGWLHTGDAG       480
     FLDEQGHLVV IDRAKDVLTT SDGTRFSSAF IENKLKFSPY VEEAVTFPTD HGMTAMITID       540
     PMTTGSWAEH ERLSYTTYTD LAGKQEVRDL IAEEVLRANE DLPESIRIKR FVLLHKQFDP       600
     DDDEITRTRK VRRNVIAERY ADIINGLAGG SDDVTIRSLV TYQDGSQVER NLVLKIVDMS       660
     TFRAPEGRGR RPVWSGRR                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page