(data stored in ACNUC7421 zone)

EMBL: CP002343.PE352

CP002343.PE352       Location/Qualifiers
FT   CDS             393210..393968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0365"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="COGs: COG1414 Transcriptional regulator; InterPro
FT                   IPR005471: IPR014757; KEGG: rop:ROP_71890 putative IclR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   IclR; SMART: regulatory protein IclR; SPTR: Putative IclR
FT                   family transcriptional regulator; PFAM: IclR
FT                   helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46914"
FT                   /db_xref="GOA:E6S7L9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L9"
FT                   /protein_id="ADU46914.1"
FT                   /translation="MPPTEVGDRDSRGSLGTVRNAVTLLELLGEGPAYQQLTDLADRSG
FT                   MSVPTVHRLLRSLVLADLVEQDPRSSRYSLGPELVRLSHRYLARLPILGALAPYLAQLR
FT                   DLVRATVVVQTLVRSAVVTIDRVDGPDAGLYREPHSVRNPLTTATGRLLGARAGDDEWK
FT                   TMLELCPESDRARAEASREAWASAPWLLVEGNPLGPPGHVAVPLLGGQGTALATLAATV
FT                   APGTSREDVEAVAGHLARAGAAAVRTLGHA"
     MPPTEVGDRD SRGSLGTVRN AVTLLELLGE GPAYQQLTDL ADRSGMSVPT VHRLLRSLVL        60
     ADLVEQDPRS SRYSLGPELV RLSHRYLARL PILGALAPYL AQLRDLVRAT VVVQTLVRSA       120
     VVTIDRVDGP DAGLYREPHS VRNPLTTATG RLLGARAGDD EWKTMLELCP ESDRARAEAS       180
     REAWASAPWL LVEGNPLGPP GHVAVPLLGG QGTALATLAA TVAPGTSRED VEAVAGHLAR       240
     AGAAAVRTLG HA                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page