(data stored in ACNUC7421 zone)

EMBL: CP002343.PE353

CP002343.PE353       Location/Qualifiers
FT   CDS             393961..395859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0366"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0365 Acyl-coenzyme A synthetase/AMP-(fatty)
FT                   acid ligase; InterPro IPR000873; KEGG: cai:Caci_4507
FT                   acetate/CoA ligase; PFAM: AMP-dependent synthetase and
FT                   ligase; SPTR: Acetate/CoA ligase; PFAM: Domain of unknown
FT                   function (DUF3448); AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46915"
FT                   /db_xref="GOA:E6S7M0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M0"
FT                   /protein_id="ADU46915.1"
FT                   /translation="MPDAVLRCDEAAWRRAAELVGWSTPFRSVCETRDGRPVWFPGGRL
FT                   NASVTCVDRHAAVDPDRVAISWEGEPGDRRVITYAELLDEVSSLAKGLRSIGVRSGDVV
FT                   ALHLGLVPEAAVAMLACARIGAVHAVLPAPLPAEALADRLESLGASVLFTQDGAWRHGT
FT                   VLPLKVRADEALTAVAGIEHTIVVRRTGMDVAWYEGDRWYHDLVAADRTRGRRSARGHR
FT                   GAEAAVDRSALDAPRGVGRVGGEAVDLPSDHPIYLISQAHRRGRPVVVTHGLANSLVTA
FT                   AALHEWGVGEGQRLWSAGDVSWLAVQTHGIYGPLARGVTTVLYEGTLDVPTHARAWEIM
FT                   RRHRVTTMMTTPSVLRTMRGWAPALADTSRVESLRRVVLYAEPSDPDLRSWAASDLGHH
FT                   PITVADGWGQVELGGICHLSRPLDPDLLPSVAPEIIDDTGRPVPEGEAGELVLTEAWAG
FT                   AMLPGAGDVAAATDHHWTTRPGLYTTGDRVRRTPEGSLEFLGRTDEVVSLSGQLVSISE
FT                   VRQTLLDHPFVQRADVIERRDTQGGRYLAAAVVLDPATAAAQDLSAVARDLNETVRDNL
FT                   GGVARPRMLVFVDRFGDELRGDERRRALAGLPLGDTPELKRITWAQVLAAADLSTP"
     MPDAVLRCDE AAWRRAAELV GWSTPFRSVC ETRDGRPVWF PGGRLNASVT CVDRHAAVDP        60
     DRVAISWEGE PGDRRVITYA ELLDEVSSLA KGLRSIGVRS GDVVALHLGL VPEAAVAMLA       120
     CARIGAVHAV LPAPLPAEAL ADRLESLGAS VLFTQDGAWR HGTVLPLKVR ADEALTAVAG       180
     IEHTIVVRRT GMDVAWYEGD RWYHDLVAAD RTRGRRSARG HRGAEAAVDR SALDAPRGVG       240
     RVGGEAVDLP SDHPIYLISQ AHRRGRPVVV THGLANSLVT AAALHEWGVG EGQRLWSAGD       300
     VSWLAVQTHG IYGPLARGVT TVLYEGTLDV PTHARAWEIM RRHRVTTMMT TPSVLRTMRG       360
     WAPALADTSR VESLRRVVLY AEPSDPDLRS WAASDLGHHP ITVADGWGQV ELGGICHLSR       420
     PLDPDLLPSV APEIIDDTGR PVPEGEAGEL VLTEAWAGAM LPGAGDVAAA TDHHWTTRPG       480
     LYTTGDRVRR TPEGSLEFLG RTDEVVSLSG QLVSISEVRQ TLLDHPFVQR ADVIERRDTQ       540
     GGRYLAAAVV LDPATAAAQD LSAVARDLNE TVRDNLGGVA RPRMLVFVDR FGDELRGDER       600
     RRALAGLPLG DTPELKRITW AQVLAAADLS TP                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page