(data stored in ACNUC7421 zone)

EMBL: CP002343.PE355

CP002343.PE355       Location/Qualifiers
FT   CDS             397612..399372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0368"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase;
FT                   InterProIPR005148: IPR015945: IPR008909: IPR001278: IPR
FT                   001412; KEGG: tfu:Tfu_0269 arginyl-tRNA synthetase; PFAM:
FT                   Arginyl-tRNA synthetase, class Ic, core; arginyl tRNA
FT                   synthetase domain protein; DALR anticodon binding domain
FT                   protein; PRIAM: Arginine--tRNA ligase; SPTR: Arginyl-tRNA
FT                   synthetase; TIGRFAM: arginyl-tRNA synthetase; PFAM: DALR
FT                   anticodon binding domain; Arginyl tRNA synthetase N
FT                   terminal domain; tRNA synthetases class I (R); TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46917"
FT                   /db_xref="GOA:E6S7M2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M2"
FT                   /protein_id="ADU46917.1"
FT                   /translation="MVSPLVALTPKVQSAIAAALGDDFREADPVLRPSQFADVQVNAAL
FT                   ALGKKVGAAPRDVAARIVAALDLDGVAEKVEVSGPGFVNITFSDAWLASLLADVDQDDR
FT                   LGVPVEEPQNIPIDYSAPNVAKEMHVGHLRTTIVGDSLARTLEHLGHHVIRQNHIGDWG
FT                   TPFGMLIEHLLEVGEDSPEAELLVTDPNAFYQAARAKFDAAEQADPDGSAGDFDIRARA
FT                   RVVKLQAGDPETLEHWHRLVGMSKVYFNKVYQALGVTLGDENLAGESTYNHLLADVCGE
FT                   LEAKGLATVSDGALCVFLDGYTGREGKPVPLIIRKSDGGYGYPTTDLATIKYRVGDLGA
FT                   HRVLYVIGAPQALHLNMVWDTARLAGWLPDDVTPVHIQIGNVLGEDRKILKTRSGSSLR
FT                   LMALLDEAVAKARGLIDETRPDLSEEERATIARQVGIGAVKYADLSVAHNSEYVFDLDR
FT                   MVSLTGNTGPYLQYVVARVRSIFRQAGLDPLTQHAPITLGTPHERALGQQLLGFGDVVT
FT                   EVGAEYEPHRLCGYLFELAQAFSAFYENCPVLKAETPELRESRLTLSALVLRTMVTGLD
FT                   LLGLESPEQM"
     MVSPLVALTP KVQSAIAAAL GDDFREADPV LRPSQFADVQ VNAALALGKK VGAAPRDVAA        60
     RIVAALDLDG VAEKVEVSGP GFVNITFSDA WLASLLADVD QDDRLGVPVE EPQNIPIDYS       120
     APNVAKEMHV GHLRTTIVGD SLARTLEHLG HHVIRQNHIG DWGTPFGMLI EHLLEVGEDS       180
     PEAELLVTDP NAFYQAARAK FDAAEQADPD GSAGDFDIRA RARVVKLQAG DPETLEHWHR       240
     LVGMSKVYFN KVYQALGVTL GDENLAGEST YNHLLADVCG ELEAKGLATV SDGALCVFLD       300
     GYTGREGKPV PLIIRKSDGG YGYPTTDLAT IKYRVGDLGA HRVLYVIGAP QALHLNMVWD       360
     TARLAGWLPD DVTPVHIQIG NVLGEDRKIL KTRSGSSLRL MALLDEAVAK ARGLIDETRP       420
     DLSEEERATI ARQVGIGAVK YADLSVAHNS EYVFDLDRMV SLTGNTGPYL QYVVARVRSI       480
     FRQAGLDPLT QHAPITLGTP HERALGQQLL GFGDVVTEVG AEYEPHRLCG YLFELAQAFS       540
     AFYENCPVLK AETPELRESR LTLSALVLRT MVTGLDLLGL ESPEQM                      586
//

If you have problems or comments...

PBIL Back to PBIL home page