(data stored in SCRATCH zone)

EMBL: CP002343.PE357

CP002343.PE357       Location/Qualifiers
FT   CDS             400798..402078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0370"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG0644 Dehydrogenase (flavoprotein); InterPro
FT                   IPR006076: IPR003042; KEGG: sen:SACE_3335 monooxygenase,
FT                   FAD-binding; PFAM: FAD dependent oxidoreductase; SPTR:
FT                   Monooxygenase, FAD-binding; PFAM: FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46919"
FT                   /db_xref="GOA:E6S7M4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M4"
FT                   /protein_id="ADU46919.1"
FT                   /translation="MNIRRAGAEAGKEPRTVTADVVVVGARVAGAATATHLARAGHDVL
FT                   MLDRGAFPSDTVSTHVIARSGMVLLSRLGVLQQLVEEGAPPLRRVEFASRLGSVQRDIK
FT                   DRYGTDFVLAPRRYALDDVLQRTALAAGARLHEGFSVDVVLTDATGRAIGVHGHDERGP
FT                   VEVRAAHVVGADGLSSRVARCLGAQPTVVRPAFGACQYAYFAGAWDAVEYHLGDGVFAG
FT                   VFPTHGGEACVWAITPEAVARRYRNGRRGGHGHPTRGGADAALAHLLRDRLPDLADRLG
FT                   PGSQQGPVRGMLRMPNHFRRAHGPGWSLVGDAGYHRDAITGHGISDALCQAELAAAAIE
FT                   ASLRCPSQEAEALADYEGHRDRMSLPIFETTVALAAFPDQSTFIELQRRLAVEIDELAE
FT                   ELYDRPLPVGAPNHPSPEMKEAATHVH"
     MNIRRAGAEA GKEPRTVTAD VVVVGARVAG AATATHLARA GHDVLMLDRG AFPSDTVSTH        60
     VIARSGMVLL SRLGVLQQLV EEGAPPLRRV EFASRLGSVQ RDIKDRYGTD FVLAPRRYAL       120
     DDVLQRTALA AGARLHEGFS VDVVLTDATG RAIGVHGHDE RGPVEVRAAH VVGADGLSSR       180
     VARCLGAQPT VVRPAFGACQ YAYFAGAWDA VEYHLGDGVF AGVFPTHGGE ACVWAITPEA       240
     VARRYRNGRR GGHGHPTRGG ADAALAHLLR DRLPDLADRL GPGSQQGPVR GMLRMPNHFR       300
     RAHGPGWSLV GDAGYHRDAI TGHGISDALC QAELAAAAIE ASLRCPSQEA EALADYEGHR       360
     DRMSLPIFET TVALAAFPDQ STFIELQRRL AVEIDELAEE LYDRPLPVGA PNHPSPEMKE       420
     AATHVH                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page