(data stored in ACNUC7421 zone)

EMBL: CP002343.PE358

CP002343.PE358       Location/Qualifiers
FT   CDS             402068..402628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0371"
FT                   /product="OsmC family protein"
FT                   /note="COGs: COG1765 redox protein regulator of disulfide
FT                   bond formation; InterPro IPR003718; KEGG: ade:Adeh_2254
FT                   OsmC-like protein; PFAM: OsmC family protein; SPTR:
FT                   OsmC-like protein; PFAM: OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46920"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M5"
FT                   /protein_id="ADU46920.1"
FT                   /translation="MSTETAHRNGVDTPTLFATLDAVRETPAAAHFQFRAHNEWIDGTH
FT                   SLSRIHDFFGVGEERTHERVFTFDADHPAVLVGRDRGPTPVELLLHAIAACITAGIANI
FT                   ASARKVTLTEVRSTVRGDIDLNGILGLQDVRNGFQHVTVTFQVKGDAPEAVLREIVEQS
FT                   RQRSAVYDVMANGVPVDLRVEVG"
     MSTETAHRNG VDTPTLFATL DAVRETPAAA HFQFRAHNEW IDGTHSLSRI HDFFGVGEER        60
     THERVFTFDA DHPAVLVGRD RGPTPVELLL HAIAACITAG IANIASARKV TLTEVRSTVR       120
     GDIDLNGILG LQDVRNGFQH VTVTFQVKGD APEAVLREIV EQSRQRSAVY DVMANGVPVD       180
     LRVEVG                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page