(data stored in ACNUC7421 zone)

EMBL: CP002343.PE361

CP002343.PE361       Location/Qualifiers
FT   CDS             403500..403904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0374"
FT                   /product="protein of unknown function DUF302"
FT                   /note="COGs: COG3439 conserved hypothetical protein;
FT                   InterPro IPR005180: IPR016796; KEGG: nml:Namu_0357 protein
FT                   of unknown function DUF302; PFAM: protein of unknown
FT                   function DUF302; SPTR: Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function DUF302"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46923"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:E6S819"
FT                   /protein_id="ADU46923.1"
FT                   /translation="MDHAITVTTGLPFEAALQATRERLSEEGFGILSEIDLAGTLKAKI
FT                   GADLPPQVILGACRPPLAHAAIQAEPSIGVFLPCNVVVRVDEAGRTVVQAMNPDFMTQI
FT                   ASGAALADVAADAKARITRALDAVAAAPVS"
     MDHAITVTTG LPFEAALQAT RERLSEEGFG ILSEIDLAGT LKAKIGADLP PQVILGACRP        60
     PLAHAAIQAE PSIGVFLPCN VVVRVDEAGR TVVQAMNPDF MTQIASGAAL ADVAADAKAR       120
     ITRALDAVAA APVS                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page