(data stored in SCRATCH zone)

EMBL: CP002343.PE364

CP002343.PE364       Location/Qualifiers
FT   CDS             complement(406204..407403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0377"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase;
FT                   InterProIPR020616: IPR020617: IPR002155: IPR020615: IPR
FT                   020610: IPR001412: IPR020613: IPR012793; KEGG:
FT                   nml:Namu_0875 beta-ketoadipyl CoA thiolase; PFAM:
FT                   Thiolase-like; SPTR: Beta-ketoadipyl CoA thiolase; TIGRFAM:
FT                   beta-ketoadipyl CoA thiolase; acetyl-CoA acetyltransferase;
FT                   PFAM: Thiolase, C-terminal domain; Thiolase, N-terminal
FT                   domain; TIGRFAM: acetyl-CoA acetyltransferases;
FT                   beta-ketoadipyl CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46926"
FT                   /db_xref="GOA:E6S822"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E6S822"
FT                   /protein_id="ADU46926.1"
FT                   /translation="MSTAYLVAGVRTPIGRYAGGLAPVRTDDLAAHAVSSLVDRFPAID
FT                   WGRVDDVILGCANQAGEDNRNVARMAGLLAGLPVQVPGLTVNRLCASGLDAVGAAARAI
FT                   RAGDADLVIAGGVESMTRAPLVMPKPDSAWSRRAEVHDTTIGWRFVNPRMDERYGTDSM
FT                   PGTAQIVADEYDISREDQDAFALRSQERAAKAIASGRLAREIVPVEIQGRKGAVSVVDT
FT                   DEHPRTTSLEALANLRPIFPGGSVTAGNASGVNDGAAALLVASEAAVSRYGLTPLARIT
FT                   TSLSVGVEPRVMGMGPDPAVKALLARTGLEVGDIDLFELNEAFASQSLAVLRALGLPDD
FT                   AEHVNPNGGAIALGHPLGMSGARLALTAAVELADRGVRRALATMCVGVGQGGALLLEAV
FT                   "
     MSTAYLVAGV RTPIGRYAGG LAPVRTDDLA AHAVSSLVDR FPAIDWGRVD DVILGCANQA        60
     GEDNRNVARM AGLLAGLPVQ VPGLTVNRLC ASGLDAVGAA ARAIRAGDAD LVIAGGVESM       120
     TRAPLVMPKP DSAWSRRAEV HDTTIGWRFV NPRMDERYGT DSMPGTAQIV ADEYDISRED       180
     QDAFALRSQE RAAKAIASGR LAREIVPVEI QGRKGAVSVV DTDEHPRTTS LEALANLRPI       240
     FPGGSVTAGN ASGVNDGAAA LLVASEAAVS RYGLTPLARI TTSLSVGVEP RVMGMGPDPA       300
     VKALLARTGL EVGDIDLFEL NEAFASQSLA VLRALGLPDD AEHVNPNGGA IALGHPLGMS       360
     GARLALTAAV ELADRGVRRA LATMCVGVGQ GGALLLEAV                              399
//

If you have problems or comments...

PBIL Back to PBIL home page