(data stored in ACNUC7421 zone)

EMBL: CP002343.PE365

CP002343.PE365       Location/Qualifiers
FT   CDS             complement(407400..409025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0378"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR000873:
FT                   IPR020845; KEGG: nca:Noca_4296 cyclohexanecarboxylate-CoA
FT                   ligase; PFAM: AMP-dependent synthetase and ligase; SPTR:
FT                   AMP-dependent synthetase and ligase; PFAM: AMP-binding
FT                   enzyme; TIGRFAM: cyclohexanecarboxylate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46927"
FT                   /db_xref="GOA:E6S823"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S823"
FT                   /protein_id="ADU46927.1"
FT                   /translation="MTFETRLNDELIAKYTDGGFWVNRLITDYLDEWAERTPDKVAFID
FT                   SRRQVTYAELRAEVDRCALGLLELGIEPGDVVSFQLPNWIDWVVLHYACTRIGAISNPL
FT                   IPIYREREVAFMVGLAGSKLIVVPREFRGFDHVSLVESLKPDWPALDHILVVGGPEAPA
FT                   SWEVFMSTPWEERRDPAELAALRPDPNDVTLLIFTSGTTGEPKGVMHSHNTVVAANNPL
FT                   PERLGISTESVIHMASTLAHLTGFLYGARLPVQNGATGILQDIWDPKEFIGLVERHGIT
FT                   YTSAATPFLHDVLSVPDVNQHPMSTLSRFCCMGAPIPRALVRRAKELLPSMAVLGGWGQ
FT                   TENALVTLGIPGDPEEKVVETDGYPWPGMQIRTVDFDGVPVPAGTEGRLQVQGPFLFVG
FT                   YANRMKMTQDSFEGDWFDTGDLAIIDEDGYVKLSGRTKDVIIRGGENIPVAYVENALYE
FT                   DPRIESVAIVGLPDPRLQERAAAVVTLTPGSTLSFEEMQVLLKEKGIAKQYWPERLEVI
FT                   DALPRTASGKIQKFQLRDRFGETS"
     MTFETRLNDE LIAKYTDGGF WVNRLITDYL DEWAERTPDK VAFIDSRRQV TYAELRAEVD        60
     RCALGLLELG IEPGDVVSFQ LPNWIDWVVL HYACTRIGAI SNPLIPIYRE REVAFMVGLA       120
     GSKLIVVPRE FRGFDHVSLV ESLKPDWPAL DHILVVGGPE APASWEVFMS TPWEERRDPA       180
     ELAALRPDPN DVTLLIFTSG TTGEPKGVMH SHNTVVAANN PLPERLGIST ESVIHMASTL       240
     AHLTGFLYGA RLPVQNGATG ILQDIWDPKE FIGLVERHGI TYTSAATPFL HDVLSVPDVN       300
     QHPMSTLSRF CCMGAPIPRA LVRRAKELLP SMAVLGGWGQ TENALVTLGI PGDPEEKVVE       360
     TDGYPWPGMQ IRTVDFDGVP VPAGTEGRLQ VQGPFLFVGY ANRMKMTQDS FEGDWFDTGD       420
     LAIIDEDGYV KLSGRTKDVI IRGGENIPVA YVENALYEDP RIESVAIVGL PDPRLQERAA       480
     AVVTLTPGST LSFEEMQVLL KEKGIAKQYW PERLEVIDAL PRTASGKIQK FQLRDRFGET       540
     S                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page