(data stored in ACNUC7421 zone)

EMBL: CP002343.PE367

CP002343.PE367       Location/Qualifiers
FT   CDS             complement(409833..410984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0380"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase; InterPro
FT                   IPR006092: IPR006091: IPR006090; KEGG: nca:Noca_4298
FT                   acyl-CoA dehydrogenase domain-containing protein; PFAM:
FT                   acyl-CoA dehydrogenase domain-containing protein; SPTR:
FT                   Acyl-CoA dehydrogenase domain protein; PFAM: Acyl-CoA
FT                   dehydrogenase, C-terminal domain; Acyl-CoA dehydrogenase,
FT                   middle domain; Acyl-CoA dehydrogenase, N-terminal domain;
FT                   TIGRFAM: cyclohexanecarboxyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46929"
FT                   /db_xref="GOA:E6S825"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S825"
FT                   /protein_id="ADU46929.1"
FT                   /translation="MHYAFDEDQDTYAHEVRKFAVKTLAPHYQSDDKAAEFRRQLALDM
FT                   AAMGLTGLRIPEEYGGQEATAVIAGIAAEEVGREDFNAGYLIINTALISDIIVRNATDE
FT                   QKAAWLPGIASGETIPCICITEPGHGTDAASLELKATPSADATGWTLHGEKTSITLGMA
FT                   SDRAVVLARTGGPGARGVSAFWVDLHHPSVSRSAFDDLGSRAIGRASLHFDGTPVSRAD
FT                   LIGEEGAGFVSVMQGFDYSRAIIGLLCIGAAQASLDEAIQWARDREAFGAPIGTFQGVS
FT                   FPLAEAATYLKGARHVCFEALWRKDTDQEHSAEAAMAKFWAPKLAADVIHQCLLTIGHI
FT                   GYSSEHKVGQRLRDVIGLEIGDGTAQVSKLVISRNLLGRKYAP"
     MHYAFDEDQD TYAHEVRKFA VKTLAPHYQS DDKAAEFRRQ LALDMAAMGL TGLRIPEEYG        60
     GQEATAVIAG IAAEEVGRED FNAGYLIINT ALISDIIVRN ATDEQKAAWL PGIASGETIP       120
     CICITEPGHG TDAASLELKA TPSADATGWT LHGEKTSITL GMASDRAVVL ARTGGPGARG       180
     VSAFWVDLHH PSVSRSAFDD LGSRAIGRAS LHFDGTPVSR ADLIGEEGAG FVSVMQGFDY       240
     SRAIIGLLCI GAAQASLDEA IQWARDREAF GAPIGTFQGV SFPLAEAATY LKGARHVCFE       300
     ALWRKDTDQE HSAEAAMAKF WAPKLAADVI HQCLLTIGHI GYSSEHKVGQ RLRDVIGLEI       360
     GDGTAQVSKL VISRNLLGRK YAP                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page