(data stored in ACNUC7421 zone)

EMBL: CP002343.PE369

CP002343.PE369       Location/Qualifiers
FT   CDS             411964..412566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0382"
FT                   /product="transcriptional regulator"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647: IPR006665; KEGG: nml:Namu_0880 transcriptional
FT                   regulator, TetR family; PFAM: regulatory protein TetR;
FT                   SPTR: Transcriptional regulator, TetR family; PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46931"
FT                   /db_xref="GOA:E6S827"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:E6S827"
FT                   /protein_id="ADU46931.1"
FT                   /translation="MATAVTRQERMQRRRVEIIQAAVELFQELGFHAATTHQVAERAGL
FT                   SVGLIYQYFGNKEDLLRSVIVDILGQFRDRIPSAIAAAGPDPVARLRAGYRAYVDVIDE
FT                   NREGALLTYREGLTLSPDGRDEIKKLEIETAAPLRDVILEGIASGAFTDVDAELVVHNL
FT                   VLTAHGWALKHWRLAKTYDVDGYADRQLDLLLRAIRP"
     MATAVTRQER MQRRRVEIIQ AAVELFQELG FHAATTHQVA ERAGLSVGLI YQYFGNKEDL        60
     LRSVIVDILG QFRDRIPSAI AAAGPDPVAR LRAGYRAYVD VIDENREGAL LTYREGLTLS       120
     PDGRDEIKKL EIETAAPLRD VILEGIASGA FTDVDAELVV HNLVLTAHGW ALKHWRLAKT       180
     YDVDGYADRQ LDLLLRAIRP                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page