(data stored in SCRATCH zone)

EMBL: CP002343.PE370

CP002343.PE370       Location/Qualifiers
FT   CDS             complement(412642..413391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0383"
FT                   /product="respiratory nitrate reductase gamma subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="COGs: COG2181 Nitrate reductase gamma subunit;
FT                   InterPro IPR003816; KEGG: nca:Noca_1349 respiratory nitrate
FT                   reductase gamma subunit; PFAM: Nitrate reductase gamma
FT                   subunit; PRIAM: Nitrate reductase; SPTR: Respiratory
FT                   nitrate reductase gamma subunit; TIGRFAM: respiratory
FT                   nitrate reductase, gamma subunit; PFAM: Nitrate reductase
FT                   gamma subunit; TIGRFAM: respiratory nitrate reductase,
FT                   gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46932"
FT                   /db_xref="GOA:E6S828"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:E6S828"
FT                   /protein_id="ADU46932.1"
FT                   /translation="MSTFLWVIFPYICLAVFVVGHWWRYRYDKFGWTTRSSQLYESRML
FT                   RWGSPLFHFGLLGVVGGHVIGLVIPQSWTEAVGMSETLYHWVAVIGGMISGLMVLAGLV
FT                   ILIYRRRTVGPVFSATTPMDKTMYFFLALVIVLGMWNTIASSIFGLGGSEGHAFNYRES
FT                   VSLWFRQIFYGQPDPGLMANAPLGFQLHALVAFFLFALWPFTRLVHVFSAPLGYVTRPY
FT                   IVYRSKDEREGTAVGTRAPKRGWERVQ"
     MSTFLWVIFP YICLAVFVVG HWWRYRYDKF GWTTRSSQLY ESRMLRWGSP LFHFGLLGVV        60
     GGHVIGLVIP QSWTEAVGMS ETLYHWVAVI GGMISGLMVL AGLVILIYRR RTVGPVFSAT       120
     TPMDKTMYFF LALVIVLGMW NTIASSIFGL GGSEGHAFNY RESVSLWFRQ IFYGQPDPGL       180
     MANAPLGFQL HALVAFFLFA LWPFTRLVHV FSAPLGYVTR PYIVYRSKDE REGTAVGTRA       240
     PKRGWERVQ                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page