(data stored in ACNUC7421 zone)

EMBL: CP002343.PE372

CP002343.PE372       Location/Qualifiers
FT   CDS             complement(414161..415813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0385"
FT                   /product="respiratory nitrate reductase beta subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="COGs: COG1140 Nitrate reductase beta subunit;
FT                   InterPro IPR017896: IPR006547; KEGG: kfl:Kfla_4151 nitrate
FT                   reductase, beta subunit; SPTR: Nitrate reductase, beta
FT                   subunit; TIGRFAM: nitrate reductase, beta subunit; TIGRFAM:
FT                   nitrate reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46934"
FT                   /db_xref="GOA:E6S830"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="UniProtKB/TrEMBL:E6S830"
FT                   /protein_id="ADU46934.1"
FT                   /translation="MKIMAQMAMVMNLDKCIGCHTCSVTCKQAWTNRAGTEYVWFNNVE
FT                   TRPGLGYPRTYEDQETWEGGWVRKANGRLTLRAGGRWKKLATIFSNPKLPSIEDYYEPW
FT                   TYDYATLLSSPASSTFPVARPQSLISGKQMNIQWSANWDDDLGGSLEHAAKDPMLKGIE
FT                   DKVKFEFEQTFMFYLPRICEHCLNPSCAASCPSGAIYKRSEDGIVLVDQDKCRGWRMCV
FT                   SGCPYKKVYFNHKTGKAEKCTFCYPRIEVGIPTVCAETCVGRLRYIGLMLYDADKVLEA
FT                   ASVENDHDLYEAQRDVFLDPNDPAVAHAAEQAGIPLDWIEAAKKSPVRRLIQDYKVALP
FT                   LHPEYRTMPMVWYIPPLSPVVDVVRDTGFDAEDKGNLFAAIEALRIPVEYLANLFTAGD
FT                   VEPVNDVLRKLAAMRSFMRDINLGGDPDASIAEAVGMDAESMYEMFRLLAIAKYDDRYV
FT                   IPTAHVEQAHGLEELATECPVDFDYEPTTGIFGEGSGDLTPVAVENFRMLEERQKSDEL
FT                   VAGGSKRGRVNLLNWDGKGAPRGLFPHRKKQDR"
     MKIMAQMAMV MNLDKCIGCH TCSVTCKQAW TNRAGTEYVW FNNVETRPGL GYPRTYEDQE        60
     TWEGGWVRKA NGRLTLRAGG RWKKLATIFS NPKLPSIEDY YEPWTYDYAT LLSSPASSTF       120
     PVARPQSLIS GKQMNIQWSA NWDDDLGGSL EHAAKDPMLK GIEDKVKFEF EQTFMFYLPR       180
     ICEHCLNPSC AASCPSGAIY KRSEDGIVLV DQDKCRGWRM CVSGCPYKKV YFNHKTGKAE       240
     KCTFCYPRIE VGIPTVCAET CVGRLRYIGL MLYDADKVLE AASVENDHDL YEAQRDVFLD       300
     PNDPAVAHAA EQAGIPLDWI EAAKKSPVRR LIQDYKVALP LHPEYRTMPM VWYIPPLSPV       360
     VDVVRDTGFD AEDKGNLFAA IEALRIPVEY LANLFTAGDV EPVNDVLRKL AAMRSFMRDI       420
     NLGGDPDASI AEAVGMDAES MYEMFRLLAI AKYDDRYVIP TAHVEQAHGL EELATECPVD       480
     FDYEPTTGIF GEGSGDLTPV AVENFRMLEE RQKSDELVAG GSKRGRVNLL NWDGKGAPRG       540
     LFPHRKKQDR                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page