(data stored in ACNUC7421 zone)

EMBL: CP002343.PE373

CP002343.PE373       Location/Qualifiers
FT   CDS             complement(415840..419550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0386"
FT                   /product="respiratory nitrate reductase alpha subunit
FT                   apoprotein"
FT                   /EC_number="1.7.99.4"
FT                   /note="COGs: COG5013 Nitrate reductase alpha subunit;
FT                   InterPro IPR006656: IPR006657: IPR006655: IPR006468; KEGG:
FT                   nca:Noca_1346 respiratory nitrate reductase alpha subunit
FT                   apoprotein; PFAM: molybdopterin oxidoreductase;
FT                   molydopterin dinucleotide-binding region; PRIAM: Nitrate
FT                   reductase; SPTR: Respiratory nitrate reductase alpha
FT                   subunit apoprotein; TIGRFAM: nitrate reductase, alpha
FT                   subunit; PFAM: Molybdopterin oxidoreductase; Molydopterin
FT                   dinucleotide binding domain; TIGRFAM: respiratory nitrate
FT                   reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46935"
FT                   /db_xref="GOA:E6S831"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:E6S831"
FT                   /protein_id="ADU46935.1"
FT                   /translation="MNASPTGLTETGLDGPLSEALVGTRRFFTKAKVSEDKRSMEAKGG
FT                   RTGDAFYRDRWSHDKVVRSTHGVNCTGSCSWKVYVKDGIITWEAQQTDYPSPGADRPDY
FT                   EPRGCPRGAAFSWYTYSPTRVRYPYVRGVLLEMYRAAKSAHGGDPVLAWGSIVEDPDKS
FT                   RRYKKARGKGGLVRATWEEVTELVAAAHVYTVKRFGPDRIAGFSPIPAMSPVSYASGAR
FT                   FLELVGAPMLSFYDWYADLPNASPQMFGDQTDVPESGDWWDAGYLIMWGSNVPLTRTPD
FT                   AHWMTEARYRGQKVLAVAPDYAENVKFADEWVTTAPGTDGALAMGMGHVILKEYFVDQQ
FT                   VPFFADYNKRFTDLPYLISLVRGDDGTYRPGKYLVAGDIEGGPKSDSENAMWKPAVLDA
FT                   ATGEVAIPNGSIGDRFGDEGLGRWNLELGDLDPALSLYGHHDEAVEVSLPRFDAADGRV
FT                   AHESRGVPVRRVGDHVVTTVFDLLLAQYGVAREGLPGAWPTGYDDPSVPATPAWQQQHT
FT                   SVPAEQVTRLAREWAQNAIDTTGRGMILLGAGTNHWFHSDQIYRAILLLTTITGTQGRN
FT                   GGGWAHYVGQEKIRPIMGFQHMAFALDWQRPPRHMNQTAYWYVHTSQYRYDTFSADDLD
FT                   SGTGVFAGKSVMDLLAQSVRLGWTPSYPTFDRSSLDLADDAEAAGMEPPAYVVQQLKEG
FT                   KLHFAVEDPEAENNYPRILSLWRSNLLGSSAKGNEYFLRHLLGTDSAATAEEAGPDQRP
FT                   ATIRWADEAGEGKLDLLMTIDFRMTSSTIFSDVVLPAATWYEKHDLSTTDMHPFIHSFN
FT                   PAINPPWQTKSDWDAWKAVAKKFSELAVDHLGTRKDVVAKPLWHDTPEAMATVHGVVKD
FT                   WRAGECEPVPGKTMPVLAVAERDYTAIYDKMITIGPLLEKVGMLTKGVAYDVKREVEIL
FT                   RGRNGVQHGGVGNGQPKVETDVQMADAMLHLAGVSNGHLATQGFRFLEKRTGTQLADLA
FT                   AEHEGKQITFADTQVAPVPVITSPEWSGSESGGRRYSPFTINIERSKPFHTLTGRQQFY
FT                   VDHDWFLGMGEMLPVYRPPLNMTTLFGESPIGEQNELGVSVRYLTPHNKWSIHSEYQDN
FT                   LFMLSLSRGGQSVWMSDRDAAKIGVKDNDWIEMVNRNGVVAARAIVSHRMPEGTVYMHH
FT                   AQDRLIDVPLTERDHKRGGIHNSLTRILLKPNHIVGGYAQLAYFFNYIGPIGNNRDEVT
FT                   MIRRRTAPVEY"
     MNASPTGLTE TGLDGPLSEA LVGTRRFFTK AKVSEDKRSM EAKGGRTGDA FYRDRWSHDK        60
     VVRSTHGVNC TGSCSWKVYV KDGIITWEAQ QTDYPSPGAD RPDYEPRGCP RGAAFSWYTY       120
     SPTRVRYPYV RGVLLEMYRA AKSAHGGDPV LAWGSIVEDP DKSRRYKKAR GKGGLVRATW       180
     EEVTELVAAA HVYTVKRFGP DRIAGFSPIP AMSPVSYASG ARFLELVGAP MLSFYDWYAD       240
     LPNASPQMFG DQTDVPESGD WWDAGYLIMW GSNVPLTRTP DAHWMTEARY RGQKVLAVAP       300
     DYAENVKFAD EWVTTAPGTD GALAMGMGHV ILKEYFVDQQ VPFFADYNKR FTDLPYLISL       360
     VRGDDGTYRP GKYLVAGDIE GGPKSDSENA MWKPAVLDAA TGEVAIPNGS IGDRFGDEGL       420
     GRWNLELGDL DPALSLYGHH DEAVEVSLPR FDAADGRVAH ESRGVPVRRV GDHVVTTVFD       480
     LLLAQYGVAR EGLPGAWPTG YDDPSVPATP AWQQQHTSVP AEQVTRLARE WAQNAIDTTG       540
     RGMILLGAGT NHWFHSDQIY RAILLLTTIT GTQGRNGGGW AHYVGQEKIR PIMGFQHMAF       600
     ALDWQRPPRH MNQTAYWYVH TSQYRYDTFS ADDLDSGTGV FAGKSVMDLL AQSVRLGWTP       660
     SYPTFDRSSL DLADDAEAAG MEPPAYVVQQ LKEGKLHFAV EDPEAENNYP RILSLWRSNL       720
     LGSSAKGNEY FLRHLLGTDS AATAEEAGPD QRPATIRWAD EAGEGKLDLL MTIDFRMTSS       780
     TIFSDVVLPA ATWYEKHDLS TTDMHPFIHS FNPAINPPWQ TKSDWDAWKA VAKKFSELAV       840
     DHLGTRKDVV AKPLWHDTPE AMATVHGVVK DWRAGECEPV PGKTMPVLAV AERDYTAIYD       900
     KMITIGPLLE KVGMLTKGVA YDVKREVEIL RGRNGVQHGG VGNGQPKVET DVQMADAMLH       960
     LAGVSNGHLA TQGFRFLEKR TGTQLADLAA EHEGKQITFA DTQVAPVPVI TSPEWSGSES      1020
     GGRRYSPFTI NIERSKPFHT LTGRQQFYVD HDWFLGMGEM LPVYRPPLNM TTLFGESPIG      1080
     EQNELGVSVR YLTPHNKWSI HSEYQDNLFM LSLSRGGQSV WMSDRDAAKI GVKDNDWIEM      1140
     VNRNGVVAAR AIVSHRMPEG TVYMHHAQDR LIDVPLTERD HKRGGIHNSL TRILLKPNHI      1200
     VGGYAQLAYF FNYIGPIGNN RDEVTMIRRR TAPVEY                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page