(data stored in SCRATCH zone)

EMBL: CP002343.PE374

CP002343.PE374       Location/Qualifiers
FT   CDS             complement(419547..420362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0387"
FT                   /product="putative transcriptional regulator"
FT                   /note="COGs: COG2345 transcriptional regulator protein;
FT                   KEGG: nca:Noca_2106 transcriptional regulator; SPTR:
FT                   Transcriptional regulator; PFAM: IclR helix-turn-helix
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46936"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S832"
FT                   /protein_id="ADU46936.1"
FT                   /translation="MAQTASVSAGPGTDLLGSPVRRTIVDTLANLPTGVDPESGAVIPH
FT                   PGLRAQDLANRLGLHVTTVRFHLDQLVAAGLLRTSFQRRKEAGRPRKLYAIEQGSLGHV
FT                   TSDQSYRMLTELLVETLSSGSDAMPNTPEEAGARWGRRHVLDGHVGLIGQQAARSPGRW
FT                   LGKIGQMVDLLREWGYSPEVSTTNDGRTARVALHDCPFLPLAKDNTAVVCGIHRGLIRG
FT                   VLEALGEDSTEVGLTPFVAPSLCIAALTTHSSFEHPTTLNHPPRQGDHP"
     MAQTASVSAG PGTDLLGSPV RRTIVDTLAN LPTGVDPESG AVIPHPGLRA QDLANRLGLH        60
     VTTVRFHLDQ LVAAGLLRTS FQRRKEAGRP RKLYAIEQGS LGHVTSDQSY RMLTELLVET       120
     LSSGSDAMPN TPEEAGARWG RRHVLDGHVG LIGQQAARSP GRWLGKIGQM VDLLREWGYS       180
     PEVSTTNDGR TARVALHDCP FLPLAKDNTA VVCGIHRGLI RGVLEALGED STEVGLTPFV       240
     APSLCIAALT THSSFEHPTT LNHPPRQGDH P                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page