(data stored in ACNUC7421 zone)

EMBL: CP002343.PE378

CP002343.PE378       Location/Qualifiers
FT   CDS             424728..426266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0391"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="COGs: COG3288 NAD/NADP transhydrogenase alpha
FT                   subunit; InterPro IPR007886: IPR007698: IPR008143:
FT                   IPR004571; KEGG: mva:Mvan_0120 NAD(P) transhydrogenase
FT                   subunit alpha; PFAM: alanine dehydrogenase/PNT domain
FT                   protein; SPTR: NAD(P) transhydrogenase, alpha subunit;
FT                   TIGRFAM: NAD(P) transhydrogenase, alpha subunit; PFAM:
FT                   Alanine dehydrogenase/PNT, C-terminal domain; Alanine
FT                   dehydrogenase/PNT, N-terminal domain; TIGRFAM: NAD(P)
FT                   transhydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46940"
FT                   /db_xref="GOA:E6S836"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S836"
FT                   /protein_id="ADU46940.1"
FT                   /translation="MQIGVPRETRPRETRVAATPKTVGQLIALGYDVVVERGAGIGASF
FT                   DDAAYVAAGARVVDGSEAWASDIVHKVNAPSDAEITMLRPGAVLVSLMAPALSPDLVEK
FT                   LRAANVTAMAMDAVPRISRAQSLDVLSSMANIAGYRAVVEAAHQFGSFFTGQVTAAGKV
FT                   PPAKVLVVGAGVAGLAAIGTAGSLGAIVRATDARPEVAEQVESMGGEFLRVQVGELQAS
FT                   SDGYAREMGEDYNRKAAELYAEQCKDVDIIITTALIPGRPAPLLITDEMVATMRAGSVI
FT                   VDMAAANGGNVAGSVADELVVTDNGVKIIGYTDLAGRLPTQASQLYGTNLVNLMKLVTP
FT                   GKDGQLVADLEDTVVRGMTVARDGELLWPPPPIQVSAVPAPVAAAPVAKAPPPPPNPNR
FT                   KFVMMGVGAAAFALIAAFSPASFLSHFTVFALAVVVGFYVIGNVHHALHTPLMSVTNAI
FT                   SGIIVVGALIQLGVSESADVAILALAFVATLVASINIFGGFLVTRRMLTMFRKG"
     MQIGVPRETR PRETRVAATP KTVGQLIALG YDVVVERGAG IGASFDDAAY VAAGARVVDG        60
     SEAWASDIVH KVNAPSDAEI TMLRPGAVLV SLMAPALSPD LVEKLRAANV TAMAMDAVPR       120
     ISRAQSLDVL SSMANIAGYR AVVEAAHQFG SFFTGQVTAA GKVPPAKVLV VGAGVAGLAA       180
     IGTAGSLGAI VRATDARPEV AEQVESMGGE FLRVQVGELQ ASSDGYAREM GEDYNRKAAE       240
     LYAEQCKDVD IIITTALIPG RPAPLLITDE MVATMRAGSV IVDMAAANGG NVAGSVADEL       300
     VVTDNGVKII GYTDLAGRLP TQASQLYGTN LVNLMKLVTP GKDGQLVADL EDTVVRGMTV       360
     ARDGELLWPP PPIQVSAVPA PVAAAPVAKA PPPPPNPNRK FVMMGVGAAA FALIAAFSPA       420
     SFLSHFTVFA LAVVVGFYVI GNVHHALHTP LMSVTNAISG IIVVGALIQL GVSESADVAI       480
     LALAFVATLV ASINIFGGFL VTRRMLTMFR KG                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page