(data stored in ACNUC7421 zone)

EMBL: CP002343.PE38

CP002343.PE38        Location/Qualifiers
FT   CDS             complement(43100..44020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0038"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="COGs: COG0863 DNA modification methylase; InterPro
FT                   IPR002941: IPR002052: IPR001091; KEGG: bph:Bphy_3423 DNA
FT                   methylase N-4/N-6 domain-containing protein; PFAM: DNA
FT                   methylase N-4/N-6 domain protein; SPTR: DNA methylase
FT                   N-4/N-6 domain protein; PFAM: DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46600"
FT                   /db_xref="GOA:E6SEJ9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ9"
FT                   /protein_id="ADU46600.1"
FT                   /translation="MTPFVFGHAELVHTDCLTWLRRRPEKSIHAVVTDPPYGATEYTHE
FT                   QQQKLRAGKGGVWRIPPAFDGHRRAPLPRFTTMSRADLDYMHDFFYAWAEVLRPTLVPG
FT                   AHVMVACNPLVSPYISMALTKAGLERRGEIVRLVMTMRGGDRPKNAHEEFVDATVMPRS
FT                   QWEPWLLYREPLECRTVADNLRKYKTGALRRISDAQPFGDVIKSHPTRKLERQIANHPS
FT                   LKPQSFLRAVVRASLPLGEGIILDPFAGSGSTLAAAEAIGYQSIGLERDAEYFEVARQA
FT                   IPQLARLVVAGVEQVSEPIPDDDDR"
     MTPFVFGHAE LVHTDCLTWL RRRPEKSIHA VVTDPPYGAT EYTHEQQQKL RAGKGGVWRI        60
     PPAFDGHRRA PLPRFTTMSR ADLDYMHDFF YAWAEVLRPT LVPGAHVMVA CNPLVSPYIS       120
     MALTKAGLER RGEIVRLVMT MRGGDRPKNA HEEFVDATVM PRSQWEPWLL YREPLECRTV       180
     ADNLRKYKTG ALRRISDAQP FGDVIKSHPT RKLERQIANH PSLKPQSFLR AVVRASLPLG       240
     EGIILDPFAG SGSTLAAAEA IGYQSIGLER DAEYFEVARQ AIPQLARLVV AGVEQVSEPI       300
     PDDDDR                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page