(data stored in ACNUC7421 zone)

EMBL: CP002343.PE383

CP002343.PE383       Location/Qualifiers
FT   CDS             429805..430779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0396"
FT                   /product="Ribosomal small subunit Rsm22"
FT                   /note="COGs: COG5459 rRNA methylase; InterPro IPR015324;
FT                   KEGG: kfl:Kfla_2484 ribosomal small subunit Rsm22; PFAM:
FT                   Ribosomal small subunit Rsm22; SPTR: Ribosomal small
FT                   subunit Rsm22; PFAM: Mitochondrial small ribosomal subunit
FT                   Rsm22"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46945"
FT                   /db_xref="GOA:E6S841"
FT                   /db_xref="InterPro:IPR015324"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S841"
FT                   /protein_id="ADU46945.1"
FT                   /translation="MKPPEGELRHALADALRGFSQPELAAATAELVARYRQPRAAARAI
FT                   LSTPERVAAYAAYRMPATHAAMQRILEELAEGGFGPRTMIDLGGGTGAAAWAAAGAFDT
FT                   LESILVLDQVPEALALGKDLVARASTPALRSARFERALVGGGPAGTADLVTASYVLSEL
FT                   SGAQTTMLLDEMMARGRVAVLAEPGTPDGYARIIEARRRFLADGWRLLGPCPHEVDCPL
FT                   GVGDWCHFAARVNRSAEHRRIKGADLSYEDEKFSWVAAAAPGVMEPRARDSRILRHPSK
FT                   RKGLVEFRVCRPDGSAGPAVVSKREGERYRAARDRDWGDTLPG"
     MKPPEGELRH ALADALRGFS QPELAAATAE LVARYRQPRA AARAILSTPE RVAAYAAYRM        60
     PATHAAMQRI LEELAEGGFG PRTMIDLGGG TGAAAWAAAG AFDTLESILV LDQVPEALAL       120
     GKDLVARAST PALRSARFER ALVGGGPAGT ADLVTASYVL SELSGAQTTM LLDEMMARGR       180
     VAVLAEPGTP DGYARIIEAR RRFLADGWRL LGPCPHEVDC PLGVGDWCHF AARVNRSAEH       240
     RRIKGADLSY EDEKFSWVAA AAPGVMEPRA RDSRILRHPS KRKGLVEFRV CRPDGSAGPA       300
     VVSKREGERY RAARDRDWGD TLPG                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page