(data stored in SCRATCH zone)

EMBL: CP002343.PE385

CP002343.PE385       Location/Qualifiers
FT   CDS             431561..432133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0398"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /note="COGs: COG0590 Cytosine/adenosine deaminase; InterPro
FT                   IPR002125; KEGG: cfl:Cfla_0483 CMP/dCMP deaminase
FT                   zinc-binding protein; PFAM: CMP/dCMP deaminase
FT                   zinc-binding; SPTR: CMP/dCMP deaminase zinc-binding
FT                   protein; PFAM: Cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46947"
FT                   /db_xref="GOA:E6S843"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:E6S843"
FT                   /protein_id="ADU46947.1"
FT                   /translation="MGRESERPGTDAAATGETYAAWLGEALELAAATAGSDDVPVGAVV
FT                   IGSDGLVIGRGRNVREELGDPTGHAEVIALRSAAAAVGTWRLDGATLAVTLEPCVMCAG
FT                   AAIAARVERIVFGAWDPKAGACGSVWDLTRDPLATHRADVVGGVRAEEAATLLVDFFER
FT                   RRLPGADEPDWTGTVNGVRRQEGGDGP"
     MGRESERPGT DAAATGETYA AWLGEALELA AATAGSDDVP VGAVVIGSDG LVIGRGRNVR        60
     EELGDPTGHA EVIALRSAAA AVGTWRLDGA TLAVTLEPCV MCAGAAIAAR VERIVFGAWD       120
     PKAGACGSVW DLTRDPLATH RADVVGGVRA EEAATLLVDF FERRRLPGAD EPDWTGTVNG       180
     VRRQEGGDGP                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page