(data stored in ACNUC7421 zone)

EMBL: CP002343.PE387

CP002343.PE387       Location/Qualifiers
FT   CDS             433481..433747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0400"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /note="KEGG: rca:Rcas_3148 hydrogenase (NiFe) small subunit
FT                   HydA"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46949"
FT                   /db_xref="UniProtKB/TrEMBL:E6S845"
FT                   /protein_id="ADU46949.1"
FT                   /translation="MKQAIGAAAVISLAAVLHVSASIGASAHNRAHIILPSGECLIVGS
FT                   EKSVTLPDGSLHDLRPETYPADEIGTAYAADEGNSFLLKGACP"
     MKQAIGAAAV ISLAAVLHVS ASIGASAHNR AHIILPSGEC LIVGSEKSVT LPDGSLHDLR        60
     PETYPADEIG TAYAADEGNS FLLKGACP                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page