(data stored in ACNUC7421 zone)

EMBL: CP002343.PE388

CP002343.PE388       Location/Qualifiers
FT   CDS             complement(434318..434944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0401"
FT                   /product="Methyltransferase type 11"
FT                   /note="InterPro IPR013216; KEGG: afw:Anae109_4039
FT                   methyltransferase type 12; PFAM: Methyltransferase type 11;
FT                   SPTR: Methyltransferase type 12; PFAM: Methyltransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46950"
FT                   /db_xref="GOA:E6S846"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S846"
FT                   /protein_id="ADU46950.1"
FT                   /translation="MDTEHFDEKAATWDDDPGKRRQARDVARAVAAAVPVGEGTRLLEY
FT                   GAGTALVTEELLASVGPVSRVTLADNSPGMRAVLREKALSGALPADTAILDLDLEDQSA
FT                   PPDRFDLIVSSMFMHHVRRLPVVLSAFAELLVDGGRVCIADLDREDGTFHTHDFDGHHG
FT                   FDRGELRTGLEQAGLVDVTITDCTHIERDGVTYSVFLATAVKGTD"
     MDTEHFDEKA ATWDDDPGKR RQARDVARAV AAAVPVGEGT RLLEYGAGTA LVTEELLASV        60
     GPVSRVTLAD NSPGMRAVLR EKALSGALPA DTAILDLDLE DQSAPPDRFD LIVSSMFMHH       120
     VRRLPVVLSA FAELLVDGGR VCIADLDRED GTFHTHDFDG HHGFDRGELR TGLEQAGLVD       180
     VTITDCTHIE RDGVTYSVFL ATAVKGTD                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page