(data stored in ACNUC7421 zone)

EMBL: CP002343.PE390

CP002343.PE390       Location/Qualifiers
FT   CDS             complement(437648..437890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0403"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dze:Dd1591_1431 major facilitator superfamily
FT                   MFS_1; SPTR: Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46952"
FT                   /db_xref="UniProtKB/TrEMBL:E6S848"
FT                   /protein_id="ADU46952.1"
FT                   /translation="MRKNWLARTALIITLGAAPLALAIPASAATGPAPGTGLTGACNML
FT                   QAILPSGAGMGHAMTVDAPQGNAGMWRAVDVSGCS"
     MRKNWLARTA LIITLGAAPL ALAIPASAAT GPAPGTGLTG ACNMLQAILP SGAGMGHAMT        60
     VDAPQGNAGM WRAVDVSGCS                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page