(data stored in ACNUC7421 zone)

EMBL: CP002343.PE394

CP002343.PE394       Location/Qualifiers
FT   CDS             complement(442254..443009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0407"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: cwo:Cwoe_0591 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; SPTR: Methyltransferase type 11;
FT                   PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46956"
FT                   /db_xref="GOA:E6S852"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S852"
FT                   /protein_id="ADU46956.1"
FT                   /translation="MTESLRETVRATYAAAAKEASASSGACCGTTTFVELNTDDRGRVV
FT                   FGAALYDTEQIEGAEKAVEASLGCGVPTAVADLHPGETVLDLGSGAGGDVLISAKRVAP
FT                   GGKAIGIDMTPEMLELARANAREAGIDNAEFVEGYLEHIPLDEDSVDVVISNCVINLAA
FT                   DKAVVLAEAARVLRPGGRFAVSDVVADEDMDEATRSDMAAFTGCIAGALTEADYRAALA
FT                   GAGFEDIEITRTHSVHRHAWAAIVRARRG"
     MTESLRETVR ATYAAAAKEA SASSGACCGT TTFVELNTDD RGRVVFGAAL YDTEQIEGAE        60
     KAVEASLGCG VPTAVADLHP GETVLDLGSG AGGDVLISAK RVAPGGKAIG IDMTPEMLEL       120
     ARANAREAGI DNAEFVEGYL EHIPLDEDSV DVVISNCVIN LAADKAVVLA EAARVLRPGG       180
     RFAVSDVVAD EDMDEATRSD MAAFTGCIAG ALTEADYRAA LAGAGFEDIE ITRTHSVHRH       240
     AWAAIVRARR G                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page