(data stored in SCRATCH zone)

EMBL: CP002343.PE396

CP002343.PE396       Location/Qualifiers
FT   CDS             443992..444360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sna:Snas_3206 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46958"
FT                   /db_xref="UniProtKB/TrEMBL:E6S854"
FT                   /protein_id="ADU46958.1"
FT                   /translation="METGRTPEEFFTGHPFALAVFERVLEISRGAAPVAVRVSTSQVAL
FT                   RVRHGFASVWLPGQYLRHPDAEVVVSIALGRHVDSPRFKEVVHPSSKHWIHHLEVRALA
FT                   DLDDEVAGWLREAAERAG"
     METGRTPEEF FTGHPFALAV FERVLEISRG AAPVAVRVST SQVALRVRHG FASVWLPGQY        60
     LRHPDAEVVV SIALGRHVDS PRFKEVVHPS SKHWIHHLEV RALADLDDEV AGWLREAAER       120
     AG                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page