(data stored in ACNUC7421 zone)

EMBL: CP002343.PE398

CP002343.PE398       Location/Qualifiers
FT   CDS             complement(445332..446888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0412"
FT                   /product="protein of unknown function DUF853 NPT hydrolase"
FT                   /note="COGs: COG0433 ATPase; InterPro IPR008571; KEGG:
FT                   krh:KRH_08710 hypothetical protein; PFAM: protein of
FT                   unknown function DUF853 NPT hydrolase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Bacterial protein of unknown
FT                   function (DUF853)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:E6S856"
FT                   /protein_id="ADU46960.1"
FT                   /translation="MTDPAAAATQLDEIVSGYSFEGGVIKLGAAVLDGEAHPDAPVQIP
FT                   LNVLNRHGLVAGATGTGKTKTLQLMAEQLSDAGVPVFLADVKGDLSGLASPGEGGDKIT
FT                   QRAASVGMPWEGRGYPAEFYSLGGQGSGVPVRATITSFGPVLLSKVLALNATQESSLGL
FT                   IFHYADKNGLALLDLKDLRAVITYLTSDEGKADLKSLGGLSSATAGVILRNLVTFEDQG
FT                   ADRFFGEPEFDTSDFLRTTAEGKGIISCLELPQLQDRPQLFSTFLMWLLADLFHDLPEE
FT                   GDLDQPKLVFFFDEAHLLFDDASKPFMNAIEQTVRLIRSKGVGVFFVTQSPKDVPADVL
FT                   AQLGNRVQHALRAFTPDDAKALKQAIATYPHTQYDMAKLLTSLGIGEAVVTVLSEKGVP
FT                   TPVAWTRMKAPNSLMDPAPQATVDEIIARSSLTAKYAEVADRESAYELLAKRLESAPTP
FT                   AEEPDPEPTRAQPARPPKEEPGVVEQVVSSGVFRSMLRSAGTVIGREITRSIFGTSRRR
FT                   R"
     MTDPAAAATQ LDEIVSGYSF EGGVIKLGAA VLDGEAHPDA PVQIPLNVLN RHGLVAGATG        60
     TGKTKTLQLM AEQLSDAGVP VFLADVKGDL SGLASPGEGG DKITQRAASV GMPWEGRGYP       120
     AEFYSLGGQG SGVPVRATIT SFGPVLLSKV LALNATQESS LGLIFHYADK NGLALLDLKD       180
     LRAVITYLTS DEGKADLKSL GGLSSATAGV ILRNLVTFED QGADRFFGEP EFDTSDFLRT       240
     TAEGKGIISC LELPQLQDRP QLFSTFLMWL LADLFHDLPE EGDLDQPKLV FFFDEAHLLF       300
     DDASKPFMNA IEQTVRLIRS KGVGVFFVTQ SPKDVPADVL AQLGNRVQHA LRAFTPDDAK       360
     ALKQAIATYP HTQYDMAKLL TSLGIGEAVV TVLSEKGVPT PVAWTRMKAP NSLMDPAPQA       420
     TVDEIIARSS LTAKYAEVAD RESAYELLAK RLESAPTPAE EPDPEPTRAQ PARPPKEEPG       480
     VVEQVVSSGV FRSMLRSAGT VIGREITRSI FGTSRRRR                               518
//

If you have problems or comments...

PBIL Back to PBIL home page