(data stored in ACNUC7421 zone)

EMBL: CP002343.PE399

CP002343.PE399       Location/Qualifiers
FT   CDS             446919..447239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0413"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR014447; KEGG: xce:Xcel_0235 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46961"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:E6S857"
FT                   /protein_id="ADU46961.1"
FT                   /translation="MKPAYSVEVIFKAVGDTRPYPDHGLVTAKDWSNVPPRVVQLGELI
FT                   TTKSTLDLRGLLADDSTFFGDLFPHCVEWEGQLYLEDGLHRALRAALQQRPVLHARVLV
FT                   LS"
     MKPAYSVEVI FKAVGDTRPY PDHGLVTAKD WSNVPPRVVQ LGELITTKST LDLRGLLADD        60
     STFFGDLFPH CVEWEGQLYL EDGLHRALRA ALQQRPVLHA RVLVLS                      106
//

If you have problems or comments...

PBIL Back to PBIL home page