(data stored in ACNUC7421 zone)

EMBL: CP002343.PE402

CP002343.PE402       Location/Qualifiers
FT   CDS             complement(448662..449570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0416"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   kfl:Kfla_5625 binding-protein-dependent transport systems
FT                   inner membrane component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR: Putative
FT                   uncharacterized protein; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46964"
FT                   /db_xref="GOA:E6S860"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S860"
FT                   /protein_id="ADU46964.1"
FT                   /translation="MSPAPGRARRQVGPPGEPRRIGYLFVLPAFAVYAAFALYPLLKAV
FT                   YLSLWNWDGLTLATWAGLSNYADVLGDDRLRGAFGHALVLMVFFAVLPLLVGLVLAAVL
FT                   HRSQVRGLGFFRTVVFLPQVVAMVVIAVAWRRIYAPGGSLNSLLGAVGLESWTRGWLGD
FT                   YTFALPAVGVVGTWLESGLVTVLLLAGMSRIPKELYEAARLDGAGPIREFLGVTLPSIR
FT                   AEIAVALTLTVIAALKTFDLIYLTTAGGPGHSTTVPSYEVYRQAFEIGQVGLASTIGVI
FT                   LTVIIFAISFVITRIGDRVTD"
     MSPAPGRARR QVGPPGEPRR IGYLFVLPAF AVYAAFALYP LLKAVYLSLW NWDGLTLATW        60
     AGLSNYADVL GDDRLRGAFG HALVLMVFFA VLPLLVGLVL AAVLHRSQVR GLGFFRTVVF       120
     LPQVVAMVVI AVAWRRIYAP GGSLNSLLGA VGLESWTRGW LGDYTFALPA VGVVGTWLES       180
     GLVTVLLLAG MSRIPKELYE AARLDGAGPI REFLGVTLPS IRAEIAVALT LTVIAALKTF       240
     DLIYLTTAGG PGHSTTVPSY EVYRQAFEIG QVGLASTIGV ILTVIIFAIS FVITRIGDRV       300
     TD                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page